Malus sylvestris (European crab apple): 126616538 Help Entry 126616538         CDS       T09027                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism msyl  Malus sylvestris (European crab apple) Pathway msyl03083   Polycomb repressive complex msyl04120   Ubiquitin mediated proteolysis msyl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:msyl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     126616538    04120 Ubiquitin mediated proteolysis     126616538   09126 Chromosome    03083 Polycomb repressive complex     126616538  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:msyl04131]     126616538    04121 Ubiquitin system [BR:msyl04121]     126616538    03036 Chromosome and associated proteins [BR:msyl03036]     126616538 Membrane trafficking [BR:msyl04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     126616538 Ubiquitin system [BR:msyl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      126616538    Cul7 complex      126616538 Chromosome and associated proteins [BR:msyl03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      126616538   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      126616538 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  126616538 NCBI-ProteinID:  XP_050140561 LinkDB All DBs Position 3:complement(15629605..15630012) Genome browser AA seq 135 aa AA seqDB search MFEVEEAVAMESQTIKHMVEDGCAGNTIPLPNVTSAILAKVIEYCTKHREEDRAIATDSE NNFKEWDAEFIKINQNTLYDLIMAANYLNIKGLLDLTCQIVVDMIKGKAPEEIRKMFNIK NDFAPKEEEKIHREN NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgttcgaggtggaagaggcagtggccatggagtcgcagaccatcaagcacatggtggag gatggatgcgccggcaataccattcctttgccaaacgtgacgagcgccatccttgcgaaa gtcattgagtactgtacaaagcatcgtgaagaggacagggctattgctactgacagcgag aataatttcaaggagtgggatgccgagttcataaagatcaaccaaaacactctctatgac ctaataatggcggcaaactatctcaacatcaagggcctgcttgacctgacgtgtcaaatt gtggtggacatgatcaaggggaaggcacctgaagagattcgcaagatgttcaacatcaag aacgatttcgctccaaaggaagaagaaaagattcatagggagaactag

DBGET integrated database retrieval system