Malus sylvestris (European crab apple): 126618020 Help Entry 126618020         CDS       T09027                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism msyl  Malus sylvestris (European crab apple) Brite KEGG Orthology (KO) [BR:msyl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:msyl03041]     126618020   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:msyl04052]     126618020 Spliceosome [BR:msyl03041]  Complex B   Other components    Complex B specific factors     126618020 Cytokines and neuropeptides [BR:msyl04052]  Neuropeptides   Unclassified    126618020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL HCBP_related Crinkler Motif Other DBs NCBI-GeneID:  126618020 NCBI-ProteinID:  XP_050142050 LinkDB All DBs Position 4:complement(17082482..17084391) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVKVKCNEDDTIGDLKKLVAAQTGTRSDKIRIQKWYNVYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtactaaacgaccgtctggggaagaaggtgaaggtgaagtgcaacgag gatgacaccatcggcgacctgaagaagctggtggcggctcagacgggcacccgctccgac aagattcggattcagaagtggtacaacgtctacaaggaccacatcactctcaaggactac gagattcatgacggcatgggcctcgagctctactacaactga

DBGET integrated database retrieval system