Malus sylvestris (European crab apple): 126619504 Help Entry 126619504         CDS       T09027                                  Name (RefSeq) thioredoxin-like 3-3   KO K03671   thioredoxin Organism msyl  Malus sylvestris (European crab apple) Brite KEGG Orthology (KO) [BR:msyl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:msyl03110]     126619504 Chaperones and folding catalysts [BR:msyl03110]  Protein folding catalysts   Protein disulfide isomerase    126619504 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  126619504 NCBI-ProteinID:  XP_050143858 LinkDB All DBs Position 4:15440874..15441781 Genome browser AA seq 79 aa AA seqDB search MAGGVGGGGDGATDSKKGLEGTGLDLPENRHDNLNSASSDQNLKDLVLQIKSCKSPAVIN YGASWCHVCVARSFLHSVI NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggcgggaggagttggcggaggaggcgacggagccaccgacagcaagaagggattagaa ggcacgggcttggatttaccagagaatcgtcatgacaacctaaatagtgcttccagcgac caaaacctcaaagaccttgttcttcagatcaagtcctgcaaatcccctgcagttatcaat tatggtgcgtcttggtgccatgtgtgtgtagccagatccttcctgcattctgtcatctga

DBGET integrated database retrieval system