Malus sylvestris (European crab apple): 126624761 Help Entry 126624761         CDS       T09027                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism msyl  Malus sylvestris (European crab apple) Pathway msyl04145   Phagosome msyl04148   Efferocytosis msyl04620   Toll-like receptor signaling pathway msyl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:msyl00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     126624761    04148 Efferocytosis     126624761  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     126624761  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     126624761  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:msyl04131]     126624761   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msyl04147]     126624761    04031 GTP-binding proteins [BR:msyl04031]     126624761 Membrane trafficking [BR:msyl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     126624761  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     126624761   Macropinocytosis    Ras GTPases     126624761  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     126624761 Exosome [BR:msyl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126624761   Exosomal proteins of other body fluids (saliva and urine)    126624761   Exosomal proteins of colorectal cancer cells    126624761   Exosomal proteins of bladder cancer cells    126624761 GTP-binding proteins [BR:msyl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     126624761 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  126624761 NCBI-ProteinID:  XP_050149826 LinkDB All DBs Position 5:23763165..23766439 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWVPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELKKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP PKQKRKKRKAQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcctccaggttcataaagtgtgtcacagttggggatggagctgtgggaaaaacc tgtatgctcatctcctacaccagcaacactttccccacggattatgtgccaactgtgttt gacaatttcagtgcaaatgttgttgtcgatgggaacaccgttaatttggggttgtgggat actgctgggcaggaagattacaatagattaagaccattgagctaccgtggggcagatgta ttcctacttgcattctctctcataagcaaggccagctatgaaaatgttgccaagaagtgg gttcctgagttgaggcattatgcacctggtgttccaattattcttgttggaactaagctc gatcttcgagatgacaagcagttctttgtagatcaccctggtgcagtgccaattaccaca gcgcagggagaggaactaaagaagctgattggggctccggtttacatagaatgcagttca aaaacacagcagaatgtgaaagcagtctttgatgcagccattaaagtggttctccagcca ccaaagcagaagagaaagaagagaaaggcacagaaggcctgctctatattgtga

DBGET integrated database retrieval system