Malus sylvestris (European crab apple): 126624969 Help Entry 126624969         CDS       T09027                                  Name (RefSeq) calmodulin-6-like   KO K02183   calmodulin Organism msyl  Malus sylvestris (European crab apple) Pathway msyl04016   MAPK signaling pathway - plant msyl04070   Phosphatidylinositol signaling system msyl04075   Plant hormone signal transduction msyl04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:msyl00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     126624969    04070 Phosphatidylinositol signaling system     126624969    04075 Plant hormone signal transduction     126624969  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     126624969  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:msyl01009]     126624969   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:msyl04131]     126624969    03036 Chromosome and associated proteins [BR:msyl03036]     126624969   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msyl04147]     126624969 Protein phosphatases and associated proteins [BR:msyl01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      126624969 Membrane trafficking [BR:msyl04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     126624969 Chromosome and associated proteins [BR:msyl03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      126624969 Exosome [BR:msyl04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    126624969 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_9 EF-hand_6 EF-hand_1 EF-hand_8 EF_EFCAB10_C AIF-1 SPEF2_C ApeP-like DUF5580_M DUF5580 DUF5805 Motif Other DBs NCBI-GeneID:  126624969 NCBI-ProteinID:  XP_050149994 LinkDB All DBs Position 6:8378331..8379714 Genome browser AA seq 82 aa AA seqDB search MADQLTDDQLNMLKTKFNAFDPDGTGIITRDQLADVLRSLGQDPTEEELDQFVQQLGSED GNIHWDKFVELMAQTISALAGQ NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcagatcaattgacagatgatcaactgaacatgctcaagactaaattcaatgccttc gacccggatggcactggcataatcactagggatcagctggccgatgtgttgagatcgtta gggcaagatcccaccgaggaggagttggatcaatttgtgcagcagctaggcagtgaggat gggaatattcactgggataaattcgtcgaactcatggcccagacaatttctgcattagct gggcagtga

DBGET integrated database retrieval system