Malus sylvestris (European crab apple): 126632347 Help Entry 126632347         CDS       T09027                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism msyl  Malus sylvestris (European crab apple) Pathway msyl03083   Polycomb repressive complex msyl04120   Ubiquitin mediated proteolysis msyl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:msyl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     126632347    04120 Ubiquitin mediated proteolysis     126632347   09126 Chromosome    03083 Polycomb repressive complex     126632347  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:msyl04131]     126632347    04121 Ubiquitin system [BR:msyl04121]     126632347    03036 Chromosome and associated proteins [BR:msyl03036]     126632347 Membrane trafficking [BR:msyl04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     126632347 Ubiquitin system [BR:msyl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      126632347    Cul7 complex      126632347 Chromosome and associated proteins [BR:msyl03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      126632347   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      126632347 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Methyltransf_16 Med15_fungi Motif Other DBs NCBI-GeneID:  126632347 NCBI-ProteinID:  XP_050158680 LinkDB All DBs Position 8:complement(698274..699582) Genome browser AA seq 156 aa AA seqDB search MSSERKITLKSSDGETFEVDEAVALMSQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC RKHVEAAKPEERASVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcagagaggaagataactctgaagagctcggacggcgagacgttcgaggtggac gaggcggtggctttgatgtctcagacgataaagcacatggtggaggacgattgtgccgac aacgggatcccgctgcccaacgtcaccagcaagatcttggcgaaggtcatcgagtactgc cggaagcatgtcgaggccgctaagcccgaagaacgcgcctccgtcgatgaagacctcaag gcttgggacgccgaattcgtcaaggtcgaccaggccacgctcttcgatctcatcctggct gcgaattatttgaacataaagagcttgctggacctgacttgccaaacggtggcggacatg atcaagggaaaaacacccgaggagattcgcaagacgttcaacattaagaacgactttacg cccgaggaagaggaggaggtccgcagggagaaccaatgggccttcgagtga

DBGET integrated database retrieval system