Malassezia sympodialis: MSY001_0921 Help Entry MSY001_0921       CDS       T06541                                  Symbol RHO1.3 Name (RefSeq) Rho-related GTPase-like protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism msym  Malassezia sympodialis Pathway msym04145   Phagosome msym04148   Efferocytosis msym04620   Toll-like receptor signaling pathway msym05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:msym00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     MSY001_0921 (RHO1.3)    04148 Efferocytosis     MSY001_0921 (RHO1.3)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     MSY001_0921 (RHO1.3)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     MSY001_0921 (RHO1.3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:msym04131]     MSY001_0921 (RHO1.3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msym04147]     MSY001_0921 (RHO1.3)    04031 GTP-binding proteins [BR:msym04031]     MSY001_0921 (RHO1.3) Membrane trafficking [BR:msym04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     MSY001_0921 (RHO1.3)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     MSY001_0921 (RHO1.3)   Macropinocytosis    Ras GTPases     MSY001_0921 (RHO1.3)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     MSY001_0921 (RHO1.3) Exosome [BR:msym04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MSY001_0921 (RHO1.3)   Exosomal proteins of other body fluids (saliva and urine)    MSY001_0921 (RHO1.3)   Exosomal proteins of colorectal cancer cells    MSY001_0921 (RHO1.3)   Exosomal proteins of bladder cancer cells    MSY001_0921 (RHO1.3) GTP-binding proteins [BR:msym04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     MSY001_0921 (RHO1.3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  30055806 NCBI-ProteinID:  XP_018739534 LinkDB All DBs Position Unknown AA seq 172 aa AA seqDB search MDARTDIQSEYVPTVFDNYTANVMVDGRPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLIC FSIVSPSSFENAKTKWWPEVSHHAPDTPIILVGTKLDLREDPEMNARLRDRRMAPISYSQ GVQMAKEIRALRYLECSALTQKGLKSVFDEAIRGVLSPQPVKRRKANNCLVL NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atggacgctcggactgacatccagagtgaatatgttcctacggtcttcgataactatacg gccaatgtcatggtcgatggccggcctgtgaatcttggcctttgggataccgctggccaa gaggactacgaccgcctacgtcccctgtcgtacccccagacggatgtgtttctcatatgc ttctccatcgtaagcccctccagctttgaaaatgccaagaccaagtggtggccggaggtg tcgcaccacgcccccgatacccccattattcttgtgggcaccaagctggatctgcgggaa gaccctgaaatgaacgctcggctgcgcgaccgccgcatggcgccgatttcgtactcccag ggggtccaaatggcgaaggagattcgcgcactgcggtacctggaatgctctgccctcaca caaaagggccttaaaagcgtgtttgacgaagctattcggggcgtgctctcgccccagccg gtcaagcgacggaaagcgaacaactgtcttgtattgtaa

DBGET integrated database retrieval system