Malassezia sympodialis: MSY001_1318 Help Entry MSY001_1318       CDS       T06541                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism msym  Malassezia sympodialis Pathway msym04145   Phagocytosis msym04517   IgSF CAM signaling msym04814   Motor proteins Brite KEGG Orthology (KO) [BR:msym00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     MSY001_1318  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     MSY001_1318   09142 Cell motility    04814 Motor proteins     MSY001_1318  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:msym03037]     MSY001_1318    04812 Cytoskeleton proteins [BR:msym04812]     MSY001_1318 Cilium and associated proteins [BR:msym03037]  Motile cilia and associated proteins   Dynein arm    MSY001_1318 Cytoskeleton proteins [BR:msym04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      MSY001_1318 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Ground-like Motif Other DBs NCBI-GeneID:  30056203 NCBI-ProteinID:  XP_018739909 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MSDSVTPTAAPDAGKAVIKNADMDQEMQQEIVEMAADAMMRFELEKDMAAHMKRTADKKF GTTWHVIVGRSFGSFVTHESKYFLYFCMFMPAHLDLGPMAFLVWRA NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgagcgacagtgtgacgccaacggcggcacccgatgccggcaaggctgttatcaagaat gctgacatggaccaagaaatgcagcaggagatagttgagatggcagcagatgccatgatg cgcttcgaactcgagaaggatatggccgcccatatgaagcgcactgccgacaaaaagttc ggtacaacttggcacgttattgtcggtcgcagcttcgggagctttgtgacacacgagtct aagtactttctttacttttgtatgtttatgcctgctcatctagatctcggccccatggcc ttccttgtatggcgagcctaa

DBGET integrated database retrieval system