Malassezia sympodialis: MSY001_3465 Help Entry MSY001_3465       CDS       T06541                                  Symbol RHO1.4 Name (RefSeq) Rho-related GTPase-like protein   KO K04393   cell division control protein 42 Organism msym  Malassezia sympodialis Pathway msym04011   MAPK signaling pathway - yeast msym04144   Endocytosis msym05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:msym00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     MSY001_3465 (RHO1.4)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     MSY001_3465 (RHO1.4)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     MSY001_3465 (RHO1.4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:msym04131]     MSY001_3465 (RHO1.4)    03036 Chromosome and associated proteins [BR:msym03036]     MSY001_3465 (RHO1.4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msym04147]     MSY001_3465 (RHO1.4)    04031 GTP-binding proteins [BR:msym04031]     MSY001_3465 (RHO1.4) Membrane trafficking [BR:msym04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     MSY001_3465 (RHO1.4)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     MSY001_3465 (RHO1.4)   Macropinocytosis    Ras GTPases     MSY001_3465 (RHO1.4) Chromosome and associated proteins [BR:msym03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     MSY001_3465 (RHO1.4) Exosome [BR:msym04147]  Exosomal proteins   Exosomal proteins of microglial cells    MSY001_3465 (RHO1.4)   Exosomal proteins of breast milk    MSY001_3465 (RHO1.4) GTP-binding proteins [BR:msym04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     MSY001_3465 (RHO1.4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Motif Other DBs NCBI-GeneID:  30058349 NCBI-ProteinID:  XP_018741933 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MIGEDPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVTSPASYENVREKWFPEVHHH CPGVPSLIVGTQVDLRDDPAVIEKLARQKLRPITAEMGERLARELGAVKYVECSALTQKG LKNVFDEAIVAALEPPVVRKKVGAFVSRQSKCAIL NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgattggcgaagacccatacacgctaggtctctttgacacggcgggtcaggaagactac gaccgcctgcgtccgctctcgtacccccagaccgacgtattccttgtgtgcttctccgtg acgtcgccggcctcgtacgaaaacgtgcgcgaaaagtggttccctgaagtgcaccaccac tgccctggcgtgccatcgcttatcgtgggcacccaggtggatttgcgtgatgatcccgct gtcatcgagaagcttgctcggcagaagctgcgtcccatcacggccgagatgggcgagcgc ctcgcccgcgagcttggcgccgtcaaatacgtggagtgctcggctctcacgcagaagggc ttgaagaacgtctttgatgaggccattgtggctgctctggagccgcccgtggttcggaaa aaggtaggtgcctttgtctcacgccagtcgaaatgcgcgattctctaa

DBGET integrated database retrieval system