Mesoplasma syrphidae: CXP39_00850 Help Entry CXP39_00850       CDS       T05255                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism msyr  Mesoplasma syrphidae Pathway msyr01100   Metabolic pathways msyr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msyr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CXP39_00850    00074 Mycolic acid biosynthesis     CXP39_00850   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CXP39_00850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 YjdM Motif Other DBs NCBI-ProteinID:  AUF83356 UniProt:  A0A2K9BJ82 LinkDB All DBs Position 198017..198241 Genome browser AA seq 74 aa AA seqDB search MNIYEEIVKELKAKGAKGALTKETKVASIGIDSLDLMDMIVTLEDRLEIRVPDDKLMNLE TIGDLINLVEELKQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaatatttacgaagaaattgttaaagaattaaaagctaagggtgcaaaaggtgcacta acaaaagaaacaaaggttgcttcaattgggattgattcattggatttaatggatatgata gttactttggaggaccgtctagaaattagagttcctgatgataaattaatgaatcttgag acaattggtgacttaattaatcttgtcgaagaattaaagcaatag

DBGET integrated database retrieval system