Methylobacterium tardum: M6G65_04290 Help Entry M6G65_04290       CDS       T08338                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mtad  Methylobacterium tardum Pathway mtad01100   Metabolic pathways mtad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtad00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M6G65_04290    00074 Mycolic acid biosynthesis     M6G65_04290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M6G65_04290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  URD37773 LinkDB All DBs Position complement(876775..877014) Genome browser AA seq 79 aa AA seqDB search MSDIAERVKKIVAEHLGVEPEKVVESANFIDDLGADSLDTVELVMAFEEEFNVEIPDDAA ETIQTVGDAVKFLEKNSAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgagcgcgtgaagaagatcgtcgccgagcacctgggcgtggagccc gagaaggtggtcgagagcgccaacttcatcgacgacctcggtgccgacagcctcgacacc gtcgagctggtcatggccttcgaggaagagttcaacgtcgagatcccggacgacgcggcc gagaccatccagacggtcggcgacgccgtgaagttcctggagaagaactccgccgcctga

DBGET integrated database retrieval system