Candidatus Moanibacter tarae: DF168_01621 Help Entry DF168_01621       CDS       T09872                                  Name (GenBank) hypothetical protein   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism mtar  Candidatus Moanibacter tarae Pathway mtar03020   RNA polymerase Brite KEGG Orthology (KO) [BR:mtar00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     DF168_01621  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mtar03021]     DF168_01621    03400 DNA repair and recombination proteins [BR:mtar03400]     DF168_01621 Enzymes [BR:mtar01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      DF168_01621 Transcription machinery [BR:mtar03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      DF168_01621 DNA repair and recombination proteins [BR:mtar03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       DF168_01621 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  AWT60412 UniProt:  A0A2Z4AQZ8 LinkDB All DBs Position complement(1832014..1832232) Genome browser AA seq 72 aa AA seqDB search MRDDYIEEAQKIIPDPNVLINVVSRRVKQLKFGQRPLVESLERLNPEDIALREVIEGKID FDLYDSDSEEEE NT seq 219 nt NT seq  +upstreamnt  +downstreamnt ttgagagacgactatatagaggaagcacagaagatcattccggatcccaatgttctgata aacgttgtgtcgagacgtgtgaaacagctaaagttcggccaaaggcctttggttgagtct ttggaaaggttgaatccagaagatatcgcccttcgtgaggttattgaaggcaagatcgat ttcgatctctacgattcggattcagaagaagaggagtga

DBGET integrated database retrieval system