Candidatus Moanibacter tarae: DF168_01890 Help Entry DF168_01890       CDS       T09872                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mtar  Candidatus Moanibacter tarae Pathway mtar00998   Biosynthesis of various antibiotics mtar01100   Metabolic pathways mtar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DF168_01890 (acpP)    00074 Mycolic acid biosynthesis     DF168_01890 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DF168_01890 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L50 DUF1493 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AWT60672 UniProt:  A0A2Z4ARJ8 LinkDB All DBs Position 2173267..2173524 Genome browser AA seq 85 aa AA seqDB search MAEKSIEQRVTEIIVNQLNVNDEQVTPEASFLDDLGADSLDTVELIMAFEEEFKSEIDGE IPEAEAENLQTVGDVVKYLKEKSGG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaaatcgattgagcaacgcgtcacagagattatcgtaaatcagctgaacgta aatgacgaacaggttactccggaagcctctttcctcgatgacttgggagcagattcgctt gatacggtagaactcatcatggcctttgaagaggagttcaaaagcgaaattgacggagag atcccggaggcagaggcagagaacctccaaactgtgggggacgtggtgaagtatctcaag gagaaatcgggaggttga

DBGET integrated database retrieval system