KEGG   Candidatus Moanibacter tarae: DF168_02084
Entry
DF168_02084       CDS       T09872                                 
Symbol
glyQS
Name
(GenBank) Glycine--tRNA ligase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
mtar  Candidatus Moanibacter tarae
Pathway
mtar00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mtar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DF168_02084 (glyQS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtar01007]
    DF168_02084 (glyQS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mtar03016]
    DF168_02084 (glyQS)
   03029 Mitochondrial biogenesis [BR:mtar03029]
    DF168_02084 (glyQS)
Enzymes [BR:mtar01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     DF168_02084 (glyQS)
Amino acid related enzymes [BR:mtar01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   DF168_02084 (glyQS)
Transfer RNA biogenesis [BR:mtar03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    DF168_02084 (glyQS)
Mitochondrial biogenesis [BR:mtar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DF168_02084 (glyQS)
SSDB
Motif
Pfam: HGTP_anticodon tRNA-synt_2b
Other DBs
NCBI-ProteinID: AWT60860
UniProt: A0A2Z4AN99
LinkDB
Position
2395717..2397327
AA seq 536 aa
MGGEFLKQNYCGPLTLNRNRLVLDQLPAKTILWALMASSPQNESRMDRIVGLCRRRGFIF
QSSEIYGGINGFFDYGPVGVELRRNIKEAWWHDMVQLRDDIVGLDSSIIMHGDVWKTSGH
ADGFADPMVDCRESKLRYKADQIFFSDVVVDGETIGYVSVLESPAMTEEAQEEADRLKRK
LGARGQLDPINLRDFTKAKIEEIELIPSPATGKPGSLTPPRDFNMMFQTYVGALRDESAI
TYLRPETAQGIFVNFRNIVDSGRLKIPFGIAQIGKAFRNEITPRNFIFRSREFEQMEIEY
FIPPGDEWEKYHEEWIGVRLDWFDAIGLERKRLGCDVHGQDSLAHYAKACTDITFEFPFG
VQELEGIAARGDFDLSRHSEGSGKSMEYFDDATGKRYVPHVIEPSLGVDRTLLALLCSAY
QTDEIGGEKRDVLRFHPRIAPYKAGVFPLLKNKPELVNRARGIYDCLRSRWNVFYDETGA
IGRRYRRQDEIGTPYGVTVDFQTLEDGTVTLRNRDSTEQVRISEEGIVTYIAERIS
NT seq 1611 nt   +upstreamnt  +downstreamnt
gtgggaggagaattcctaaaacaaaattattgcggacccctaactctaaatcggaatcgc
ttggtgcttgaccagctaccagcaaaaaccatcctttgggcgctcatggcttcttctcca
cagaacgagtctaggatggatcgcattgtcgggctttgtcgtcgccgggggtttattttt
cagtcttccgaaatctatggcggaatcaatgggttttttgactacggtccggtcggagta
gaattgcgccgaaatatcaaggaagcttggtggcacgatatggttcagctccgtgatgat
atcgtcggcttggattcttcaattattatgcacggtgacgtatggaaaacatcaggccat
gctgatggattcgccgatcctatggttgactgtagagaatcaaagttacggtacaaagcg
gaccagattttcttttccgatgttgtggttgacggtgagacgataggttatgtttcggtt
cttgaatctcctgcgatgactgaggaggctcaggaggaggcggatagactaaagcggaaa
cttggtgcccgagggcaactggacccgatcaacttgcgtgattttactaaggccaaaata
gaggaaatcgaattgattccctcgccggccaccgggaagccggggtctctcactccaccg
cgtgattttaacatgatgtttcagacctatgttggagccctgcgcgatgaatctgcaatc
acctatctccggccggagactgcccaagggatctttgtcaactttaggaacatcgttgat
tccggccgcctgaaaattccctttggcatcgcccagattggaaaggcttttcgtaacgag
ataaccccacgtaacttcatctttcgctcccgagaattcgagcagatggagattgaatac
ttcataccccctggcgatgagtgggagaagtaccatgaagaatggattggcgttcggctg
gattggtttgatgctatcgggttggagaggaagcgcttaggttgtgatgttcacggacag
gacagtctcgcccactatgcgaaggcttgcactgatattactttcgaatttcctttcggt
gtccaagagttggaagggattgcggcgaggggcgattttgaccttagccgtcatagcgag
ggatctggaaagtcgatggaatattttgatgatgccaccggcaaacgctatgttccccat
gtgatcgagccttctctgggggtagaccggactctgcttgcgcttctttgcagtgcttat
caaaccgatgagattggtggtgaaaagcgggatgtacttcggttccatccgcgaattgcg
ccctacaaagctggggttttccctctgctaaaaaataaacctgagctggtgaacagggct
cgtgggatatacgactgtctccgctcgcgctggaacgtattctacgacgaaaccggagcg
atcggtcgtcgttatcgaagacaggacgaaattggcactccttatggggtgacggtagac
ttccagacacttgaggacggaacagttacgctccgaaatcgagattccaccgaacaagtg
cggatttcggaggagggaatagttacttatatagcggagcgtatttcctag

DBGET integrated database retrieval system