Candidatus Moanibacter tarae: DF168_02084
Help
Entry
DF168_02084 CDS
T09872
Symbol
glyQS
Name
(GenBank) Glycine--tRNA ligase
KO
K01880
glycyl-tRNA synthetase [EC:
6.1.1.14
]
Organism
mtar
Candidatus Moanibacter tarae
Pathway
mtar00970
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:
mtar00001
]
09120 Genetic Information Processing
09122 Translation
00970 Aminoacyl-tRNA biosynthesis
DF168_02084 (glyQS)
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
mtar01007
]
DF168_02084 (glyQS)
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
mtar03016
]
DF168_02084 (glyQS)
03029 Mitochondrial biogenesis [BR:
mtar03029
]
DF168_02084 (glyQS)
Enzymes [BR:
mtar01000
]
6. Ligases
6.1 Forming carbon-oxygen bonds
6.1.1 Ligases forming aminoacyl-tRNA and related compounds
6.1.1.14 glycine---tRNA ligase
DF168_02084 (glyQS)
Amino acid related enzymes [BR:
mtar01007
]
Aminoacyl-tRNA synthetase
Class II (C/G)
DF168_02084 (glyQS)
Transfer RNA biogenesis [BR:
mtar03016
]
Eukaryotic type
Aminoacyl-tRNA synthetases (AARSs)
Other AARSs
DF168_02084 (glyQS)
Mitochondrial biogenesis [BR:
mtar03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial transcription and translation factors
Other mitochondrial DNA transcription and translation factors
DF168_02084 (glyQS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
HGTP_anticodon
tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID:
AWT60860
UniProt:
A0A2Z4AN99
LinkDB
All DBs
Position
2395717..2397327
Genome browser
AA seq
536 aa
AA seq
DB search
MGGEFLKQNYCGPLTLNRNRLVLDQLPAKTILWALMASSPQNESRMDRIVGLCRRRGFIF
QSSEIYGGINGFFDYGPVGVELRRNIKEAWWHDMVQLRDDIVGLDSSIIMHGDVWKTSGH
ADGFADPMVDCRESKLRYKADQIFFSDVVVDGETIGYVSVLESPAMTEEAQEEADRLKRK
LGARGQLDPINLRDFTKAKIEEIELIPSPATGKPGSLTPPRDFNMMFQTYVGALRDESAI
TYLRPETAQGIFVNFRNIVDSGRLKIPFGIAQIGKAFRNEITPRNFIFRSREFEQMEIEY
FIPPGDEWEKYHEEWIGVRLDWFDAIGLERKRLGCDVHGQDSLAHYAKACTDITFEFPFG
VQELEGIAARGDFDLSRHSEGSGKSMEYFDDATGKRYVPHVIEPSLGVDRTLLALLCSAY
QTDEIGGEKRDVLRFHPRIAPYKAGVFPLLKNKPELVNRARGIYDCLRSRWNVFYDETGA
IGRRYRRQDEIGTPYGVTVDFQTLEDGTVTLRNRDSTEQVRISEEGIVTYIAERIS
NT seq
1611 nt
NT seq
+upstream
nt +downstream
nt
gtgggaggagaattcctaaaacaaaattattgcggacccctaactctaaatcggaatcgc
ttggtgcttgaccagctaccagcaaaaaccatcctttgggcgctcatggcttcttctcca
cagaacgagtctaggatggatcgcattgtcgggctttgtcgtcgccgggggtttattttt
cagtcttccgaaatctatggcggaatcaatgggttttttgactacggtccggtcggagta
gaattgcgccgaaatatcaaggaagcttggtggcacgatatggttcagctccgtgatgat
atcgtcggcttggattcttcaattattatgcacggtgacgtatggaaaacatcaggccat
gctgatggattcgccgatcctatggttgactgtagagaatcaaagttacggtacaaagcg
gaccagattttcttttccgatgttgtggttgacggtgagacgataggttatgtttcggtt
cttgaatctcctgcgatgactgaggaggctcaggaggaggcggatagactaaagcggaaa
cttggtgcccgagggcaactggacccgatcaacttgcgtgattttactaaggccaaaata
gaggaaatcgaattgattccctcgccggccaccgggaagccggggtctctcactccaccg
cgtgattttaacatgatgtttcagacctatgttggagccctgcgcgatgaatctgcaatc
acctatctccggccggagactgcccaagggatctttgtcaactttaggaacatcgttgat
tccggccgcctgaaaattccctttggcatcgcccagattggaaaggcttttcgtaacgag
ataaccccacgtaacttcatctttcgctcccgagaattcgagcagatggagattgaatac
ttcataccccctggcgatgagtgggagaagtaccatgaagaatggattggcgttcggctg
gattggtttgatgctatcgggttggagaggaagcgcttaggttgtgatgttcacggacag
gacagtctcgcccactatgcgaaggcttgcactgatattactttcgaatttcctttcggt
gtccaagagttggaagggattgcggcgaggggcgattttgaccttagccgtcatagcgag
ggatctggaaagtcgatggaatattttgatgatgccaccggcaaacgctatgttccccat
gtgatcgagccttctctgggggtagaccggactctgcttgcgcttctttgcagtgcttat
caaaccgatgagattggtggtgaaaagcgggatgtacttcggttccatccgcgaattgcg
ccctacaaagctggggttttccctctgctaaaaaataaacctgagctggtgaacagggct
cgtgggatatacgactgtctccgctcgcgctggaacgtattctacgacgaaaccggagcg
atcggtcgtcgttatcgaagacaggacgaaattggcactccttatggggtgacggtagac
ttccagacacttgaggacggaacagttacgctccgaaatcgagattccaccgaacaagtg
cggatttcggaggagggaatagttacttatatagcggagcgtatttcctag
DBGET
integrated database retrieval system