Mycobacterium tuberculosis CDC1551: MT1385 Help Entry MT1385            CDS       T00053                                  Symbol acp-2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mtc  Mycobacterium tuberculosis CDC1551 Pathway mtc01100   Metabolic pathways mtc01110   Biosynthesis of secondary metabolites Module mtc_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) mtc_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:mtc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MT1385 (acp-2)    00074 Mycolic acid biosynthesis     MT1385 (acp-2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MT1385 (acp-2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AAK45650 UniProt:  P9WQF0 LinkDB All DBs Position 1510182..1510502 Genome browser AA seq 106 aa AA seqDB search MWRYPLSTRLALPNTPGVASFAMTSSPSTVSTTLLSILRDDLNIDLTRVTPDARLVDDVG LDSVAFAVGMVAIEERLGVALSEEELLTCDTVGELEAAIAAKYRDE NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgtggcgatatccactaagtacaaggctagccttgcctaataccccaggtgtagcctcc ttcgccatgacctcatcgccgtccaccgtcagcactacgctgctgagcatcctgcgcgac gacctcaacattgacctgactcgagtcacgcctgatgccaggttggtcgacgatgtggga ctggattcggtggccttcgcggtcggtatggtggccatcgaggagcggctcggagtcgca ctgtccgaagaggagctcttgacgtgcgacacggtcggagaactggaggcagcgatcgcg gccaaataccgcgatgagtga

DBGET integrated database retrieval system