Mycobacterium tuberculosis CDC1551: MT3292 Help Entry MT3292            CDS       T00053                                  Name (GenBank) conserved hypothetical protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mtc  Mycobacterium tuberculosis CDC1551 Brite KEGG Orthology (KO) [BR:mtc00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     MT3292 Enzymes [BR:mtc01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      MT3292 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin_2 Thioredoxin GST_N_3 Glrx-like SH3BGR Motif Other DBs NCBI-ProteinID:  AAK47635 UniProt:  P9WN16 LinkDB All DBs Position 3566240..3566494 Genome browser AA seq 84 aa AA seqDB search MITAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVK FADGSTLTNPSADEVKAKLVKIAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgatcaccgctgcgctcaccatctatacgacatcatggtgtggctattgccttcgactc aaaacagcgctcacggccaaccgaatcgcttacgacgaggtcgacatcgaacacaaccgt gcggccgcggagttcgtcggctcggtcaatggcggcaacagaactgttcccacggtgaag ttcgccgacgggtcgacgctgactaacccgagcgcggacgaggtcaaagcgaagctggta aagatcgcgggttaa

DBGET integrated database retrieval system