Mycobacterium tuberculosis UT205: UDA_1107c Help Entry UDA_1107c         CDS       T02142                                  Symbol xseB Name (GenBank) xseB   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism mtd  Mycobacterium tuberculosis UT205 Pathway mtd03430   Mismatch repair Brite KEGG Orthology (KO) [BR:mtd00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     UDA_1107c (xseB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:mtd03400]     UDA_1107c (xseB) Enzymes [BR:mtd01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      UDA_1107c (xseB) DNA repair and recombination proteins [BR:mtd03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      UDA_1107c (xseB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Motif Other DBs NCBI-ProteinID:  CCE36634 LinkDB All DBs Position complement(1236631..1236888) Genome browser AA seq 85 aa AA seqDB search MVCDPNGDDTGRTHATVPVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAK RCEEHLAGARQRVSDVLAGDEAQNG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggtctgtgaccccaacggcgatgacacgggcagaacccacgcaactgtgcctgtcagt cagcttggctatgaagcctgccgggacgagctgatggaagtcgtgcggcttctggagcag ggcggattggacctcgatgcgtcgctgcgactgtgggaaagaggggagcaactcgccaaa aggtgcgaggagcacttagctggtgcacgccagcgggtgtccgatgtgctggccggcgac gaggcccaaaacggctaa

DBGET integrated database retrieval system