Mycobacterium tuberculosis UT205: UDA_2697c Help Entry UDA_2697c         CDS       T02142                                  Symbol dut Name (GenBank) dut   KO K01520   dUTP diphosphatase [EC:3.6.1.23] Organism mtd  Mycobacterium tuberculosis UT205 Pathway mtd00240   Pyrimidine metabolism mtd00983   Drug metabolism - other enzymes mtd01100   Metabolic pathways mtd01232   Nucleotide metabolism Module mtd_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:mtd00001]  09100 Metabolism   09104 Nucleotide metabolism    00240 Pyrimidine metabolism     UDA_2697c (dut)   09111 Xenobiotics biodegradation and metabolism    00983 Drug metabolism - other enzymes     UDA_2697c (dut)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:mtd03400]     UDA_2697c (dut) Enzymes [BR:mtd01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.23  dUTP diphosphatase      UDA_2697c (dut) DNA repair and recombination proteins [BR:mtd03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     UDA_2697c (dut)  Prokaryotic type     UDA_2697c (dut) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  dUTPase DCD Motif Other DBs NCBI-ProteinID:  CCE38158 LinkDB All DBs Position complement(3018812..3019276) Genome browser AA seq 154 aa AA seqDB search MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGL VHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVE LVELVEVSSFDEAGLASTSRGDGGHGSSGGHASL NT seq 465 nt NT seq  +upstreamnt  +downstreamnt gtgtcgaccactctggcgatcgtccgcctcgaccccgggctcccgctgcccagccgcgct cacgacggcgacgccggcgttgatctctacagcgccgaagacgtcgagctggcacctggg cgccgcgccctggtacggacgggtgttgcggtcgccgtcccgttcggcatggtcgggctg gtccatccgcgctccgggttggccacgcgggtggggctttcgatcgtcaacagtccgggc accatcgacgcgggttatcgtggggagatcaaggtggccctgatcaacttggacccagcc gcgcccatcgtggtacatcgcggtgaccgaatcgcccagttgctagtgcaacgggttgag ttggtcgagctggtcgaggtctcgtcgttcgacgaggccgggctggcctcgacatcccgc ggcgacggtggccacggttcctccggcggacatgcgagtttgtga

DBGET integrated database retrieval system