Methylobacterium terrae: DK419_12325 Help Entry DK419_12325       CDS       T06384                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mtea  Methylobacterium terrae Pathway mtea01100   Metabolic pathways mtea01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtea00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DK419_12325    00074 Mycolic acid biosynthesis     DK419_12325   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DK419_12325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AWN47006 UniProt:  A0A2U8WNW5 LinkDB All DBs Position 2721356..2721580 Genome browser AA seq 74 aa AA seqDB search MAALAPLFEEVFGEAVPLTPDLSAEDVEGWDSTRMIELVIAVEARFALKLTTREVDGLAT VGDLAALVARKAAR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcggccctggcgccgctgttcgaggaggtgttcggcgaggcggttccgctcacgccg gacctctccgccgaggatgtcgagggctgggactcgacccggatgatcgagctcgtcatc gcggtcgaggcgcggtttgccctcaagctcaccacccgggaggtcgacgggctcgcgacc gtcggcgacctcgcggcgctggtcgcccgcaaggcggcgcggtga

DBGET integrated database retrieval system