Methylobacterium terrae: DK419_19605 Help Entry DK419_19605       CDS       T06384                                  Name (GenBank) hypothetical protein   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism mtea  Methylobacterium terrae Brite KEGG Orthology (KO) [BR:mtea00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mtea03000]     DK419_19605    03036 Chromosome and associated proteins [BR:mtea03036]     DK419_19605    03400 DNA repair and recombination proteins [BR:mtea03400]     DK419_19605 Transcription factors [BR:mtea03000]  Prokaryotic type   Helix-turn-helix    Other families     DK419_19605 Chromosome and associated proteins [BR:mtea03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DK419_19605 DNA repair and recombination proteins [BR:mtea03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       DK419_19605 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 HTH_30 HTH_23 DUF2089 HTH_Tnp_ISL3 HTH_50 HTH_28 HTH_11 Sigma70_r4_2 MerR HTH_17 HTH_29 DUF1670 HTH_1 HTH_AsnC-type Motif Other DBs NCBI-ProteinID:  AWN48280 UniProt:  A0A2U8WS93 LinkDB All DBs Position complement(4229239..4229499) Genome browser AA seq 86 aa AA seqDB search MAPATTLAEAERKLVIETLIRCRGNRTHAAKMLGVSVRTVRNRIAEYKRIGVCLPIYRDV VWSDWPEGEFSSEEAGKGGVPAEMGA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggcgccagcgaccaccctcgccgaggccgagcgcaagctcgtcatcgagacgctcatc cgttgccgcggcaaccgcacccacgccgccaagatgctcggcgtctcggtccgcacggtc cgcaaccgcatcgcggaatacaagcggatcggcgtctgcctgccgatctaccgcgacgtc gtctggtcggactggccggagggggagttctcgtcggaggaggcggggaaggggggcgtg ccggcggagatgggggcctga

DBGET integrated database retrieval system