Methylobacterium terrae: DK419_26105 Help Entry DK419_26105       CDS       T06384                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mtea  Methylobacterium terrae Pathway mtea02024   Quorum sensing mtea03018   RNA degradation Brite KEGG Orthology (KO) [BR:mtea00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     DK419_26105  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     DK419_26105  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mtea03019]     DK419_26105    03036 Chromosome and associated proteins [BR:mtea03036]     DK419_26105 Messenger RNA biogenesis [BR:mtea03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      DK419_26105 Chromosome and associated proteins [BR:mtea03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DK419_26105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 AcMNPV_AC11 Motif Other DBs NCBI-ProteinID:  AWN49393 UniProt:  A0A2U8WTI8 LinkDB All DBs Position complement(5638264..5638518) Genome browser AA seq 84 aa AA seqDB search MAGERAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKH AISTIMPGHPVQLFEQGEEGAEKA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcgggcgaacgcgctcagaatctgcaggacaccttcctcaaccacgttcgcaagaac aagattccgctgacgatcttcctggtcaacggcgtgaagttgcagggtgtcgtgacctgg ttcgacaacttctgcgtgctgctgcggcgcgacggccactcgcagctggtctacaagcac gcgatctcgaccatcatgccgggccatcccgtgcagctgttcgagcagggtgaggaaggg gccgagaaggcctga

DBGET integrated database retrieval system