Methanothermobacter tenebrarum: MTTB_09110 Help Entry MTTB_09110        CDS       T08102                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mtee  Methanothermobacter tenebrarum Pathway mtee03010   Ribosome Brite KEGG Orthology (KO) [BR:mtee00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MTTB_09110   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MTTB_09110  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mtee03011]     MTTB_09110    04121 Ubiquitin system [BR:mtee04121]     MTTB_09110   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mtee04147]     MTTB_09110 Ribosome [BR:mtee03011]  Ribosomal proteins   Eukaryotes    Small subunit     MTTB_09110   Archaea     MTTB_09110 Ubiquitin system [BR:mtee04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MTTB_09110 Exosome [BR:mtee04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MTTB_09110   Exosomal proteins of colorectal cancer cells    MTTB_09110 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Ribosomal_L37e DUF5817 Zn_Ribbon_TF Alsin_RLD Zn_ribbon_NUD CoiA_N Motif Other DBs NCBI-ProteinID:  BDH79532 UniProt:  A0ABM7YDI6 LinkDB All DBs Position 841504..841656 Genome browser AA seq 50 aa AA seqDB search MSKYKLYEVKEDKIKRKNPFCPRCSSGVFMADHGDRYACGRCGYTQWKNR NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atgagcaaatataaattatatgaagtcaaagaagacaagatcaagaggaagaacccattc tgtcccagatgctcaagtggggttttcatggccgaccatggggacagatacgcgtgtgga agatgcgggtacacccaatggaaaaacaggtag

DBGET integrated database retrieval system