Micromonospora terminaliae: GCE86_21060 Help Entry GCE86_21060       CDS       T06293                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mtem  Micromonospora terminaliae Brite KEGG Orthology (KO) [BR:mtem00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     GCE86_21060 Enzymes [BR:mtem01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      GCE86_21060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_2 Thioredoxin GST_N Motif Other DBs NCBI-ProteinID:  QGL49284 LinkDB All DBs Position 4599454..4599696 Genome browser AA seq 80 aa AA seqDB search MLTMYSTSWCGYCHRLKSQLDREGIGYEVVDIEQDTKAAEFVMSVNGGNQTVPTLRFDDG SALTNPSIVQVKQHLASLAG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgttgacgatgtattccacctcgtggtgcggctactgccaccggctgaagtcgcagctc gaccgggagggcatcgggtacgaggtggtcgacatcgagcaggacacgaaggccgccgag ttcgtgatgagcgtcaacggcggcaaccagaccgtcccgaccctgcggttcgacgacggc agcgccctgaccaacccctcgatcgtccaggtcaagcagcacctggccagcctcgccggc tga

DBGET integrated database retrieval system