Methanothermobacter thermautotrophicus: MTH_1696 Help Entry MTH_1696          CDS       T00009                                  Name (GenBank) histone HMtA2   KO K24450   DNA-binding protein Organism mth  Methanothermobacter thermautotrophicus Brite KEGG Orthology (KO) [BR:mth00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mth03036]     MTH_1696 Chromosome and associated proteins [BR:mth03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     MTH_1696 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C CENP-S TFIID_20kDa Bromo_TP TFIID-31kDa LonB_AAA-LID DUF1931 HK97-gp10_like Motif Other DBs NCBI-ProteinID:  AAB86168 UniProt:  O27731 LinkDB All DBs Position complement(1553655..1553861) Genome browser AA seq 68 aa AA seqDB search MAELPIAPVGRIIKNAGAQRISDDAREALAKILEEKGEEIAKEAVKLAKHAGRKTVKASD IELAAKKL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggccgaattacccatagcaccagttgggagaatcataaaaaatgccggtgcccagaga ataagcgacgacgcaagggaagcacttgcaaagattctggaagaaaaaggcgaagaaata gcaaaagaagctgttaaacttgcaaagcacgccggcagaaaaactgttaaagcatcagac atagaactggccgctaaaaagttatag

DBGET integrated database retrieval system