Methanothermobacter thermautotrophicus: MTH_268 Help Entry MTH_268           CDS       T00009                                  Name (GenBank) ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mth  Methanothermobacter thermautotrophicus Pathway mth03010   Ribosome Brite KEGG Orthology (KO) [BR:mth00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MTH_268   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MTH_268  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mth03011]     MTH_268    04121 Ubiquitin system [BR:mth04121]     MTH_268   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mth04147]     MTH_268 Ribosome [BR:mth03011]  Ribosomal proteins   Eukaryotes    Small subunit     MTH_268   Archaea     MTH_268 Ubiquitin system [BR:mth04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MTH_268 Exosome [BR:mth04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MTH_268   Exosomal proteins of colorectal cancer cells    MTH_268 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e NCD3G Baculo_ME53 Motif Other DBs NCBI-ProteinID:  AAB84774 UniProt:  O26368 LinkDB All DBs Position 205378..205533 Genome browser AA seq 51 aa AA seqDB search MKKFELYEVKDGKLVRKNPFCVRCSNGVFMADHGDRYACGKCGYTEWKNRE NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgaagaaatttgagctctacgaggtcaaggacggtaaactcgtcaggaagaaccccttc tgtgtcaggtgctcaaacggtgtcttcatggcagaccatggggacaggtacgcctgcggt aaatgcggatacaccgaatggaaaaacagggaatag

DBGET integrated database retrieval system