Methanothermobacter thermautotrophicus: MTH_553 Help Entry MTH_553           CDS       T00009                                  Name (GenBank) ribosomal protein L40   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mth  Methanothermobacter thermautotrophicus Pathway mth03010   Ribosome Brite KEGG Orthology (KO) [BR:mth00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MTH_553   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MTH_553  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mth03011]     MTH_553    04121 Ubiquitin system [BR:mth04121]     MTH_553 Ribosome [BR:mth03011]  Ribosomal proteins   Eukaryotes    Large subunit     MTH_553   Archaea     MTH_553 Ubiquitin system [BR:mth04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MTH_553 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_Ribbon_1 Ribosomal_L40e DZR DUF6079_6th DZR_2 DHHC Zn_ribbon_RanBP HVO_0416 Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  AAB85059 UniProt:  O26653 LinkDB All DBs Position complement(500320..500466) Genome browser AA seq 48 aa AA seqDB search MARFEEAENRLFNIKICLKCNARNPPTAKTCRKCGYKGLRYKAKEPRG NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atggcaaggtttgaggaagcagaaaacagactgttcaatatcaagatctgccttaaatgt aacgctaggaacccaccaactgcaaagacatgcaggaagtgtggttacaaggggttaagg tacaaggccaaggaaccaaggggttaa

DBGET integrated database retrieval system