KEGG   Methylophaga thalassica: VSX76_06415
Entry
VSX76_06415       CDS       T09743                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
mtha  Methylophaga thalassica
Pathway
mtha00770  Pantothenate and CoA biosynthesis
mtha01100  Metabolic pathways
mtha01240  Biosynthesis of cofactors
Module
mtha_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mtha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    VSX76_06415 (coaD)
Enzymes [BR:mtha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     VSX76_06415 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig FeS_assembly_P
Other DBs
NCBI-ProteinID: WVI86243
LinkDB
Position
1:938440..938928
AA seq 162 aa
MSTVAIYPGTFDPITYGHIDLIKRASPLFERIIVAVAINPGKKPMFSLDERVELVRETTK
GIENVEVCGFKGLLVNEALSMGANVIIRGLRAVSDFEYELQLATMNRRMQSKVETLFLTP
AENLSFVSSTLVKEIAVLGGDVSEFVAPCVQEALKRKLPAHN
NT seq 489 nt   +upstreamnt  +downstreamnt
ttgagcactgttgccatatatccgggtacatttgacccaattacttatgggcatattgat
cttatcaagcgtgcttcacccttatttgagcggatcattgtcgctgtggcgattaaccct
ggcaagaaaccgatgtttagtcttgatgagcgggtcgaattagtcagagaaacgaccaaa
ggcatcgagaatgtggaggtctgcggttttaaaggtcttttagtcaatgaagcactcagt
atgggggccaatgtcattattcgtggcttacgagccgtctcagattttgagtatgaatta
caattggccaccatgaatcgccgaatgcagtcaaaagtggaaaccttgttcttaacgcct
gcggaaaatttaagttttgtttcttctactttggttaaagaaattgctgtattaggtggg
gatgtctctgaatttgttgccccatgtgtacaagaagccttgaaacgcaaattgcctgcc
cataactaa

DBGET integrated database retrieval system