KEGG   Macaca thibetana thibetana (Pere David's macaque): 126929669
Entry
126929669         CDS       T08579                                 
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mthb  Macaca thibetana thibetana (Pere David's macaque)
Pathway
mthb01521  EGFR tyrosine kinase inhibitor resistance
mthb01522  Endocrine resistance
mthb01524  Platinum drug resistance
mthb04010  MAPK signaling pathway
mthb04012  ErbB signaling pathway
mthb04014  Ras signaling pathway
mthb04015  Rap1 signaling pathway
mthb04022  cGMP-PKG signaling pathway
mthb04024  cAMP signaling pathway
mthb04062  Chemokine signaling pathway
mthb04066  HIF-1 signaling pathway
mthb04068  FoxO signaling pathway
mthb04071  Sphingolipid signaling pathway
mthb04072  Phospholipase D signaling pathway
mthb04114  Oocyte meiosis
mthb04140  Autophagy - animal
mthb04148  Efferocytosis
mthb04150  mTOR signaling pathway
mthb04151  PI3K-Akt signaling pathway
mthb04210  Apoptosis
mthb04218  Cellular senescence
mthb04261  Adrenergic signaling in cardiomyocytes
mthb04270  Vascular smooth muscle contraction
mthb04350  TGF-beta signaling pathway
mthb04360  Axon guidance
mthb04370  VEGF signaling pathway
mthb04371  Apelin signaling pathway
mthb04380  Osteoclast differentiation
mthb04510  Focal adhesion
mthb04520  Adherens junction
mthb04540  Gap junction
mthb04550  Signaling pathways regulating pluripotency of stem cells
mthb04611  Platelet activation
mthb04613  Neutrophil extracellular trap formation
mthb04620  Toll-like receptor signaling pathway
mthb04621  NOD-like receptor signaling pathway
mthb04625  C-type lectin receptor signaling pathway
mthb04650  Natural killer cell mediated cytotoxicity
mthb04657  IL-17 signaling pathway
mthb04658  Th1 and Th2 cell differentiation
mthb04659  Th17 cell differentiation
mthb04660  T cell receptor signaling pathway
mthb04662  B cell receptor signaling pathway
mthb04664  Fc epsilon RI signaling pathway
mthb04666  Fc gamma R-mediated phagocytosis
mthb04668  TNF signaling pathway
mthb04713  Circadian entrainment
mthb04720  Long-term potentiation
mthb04722  Neurotrophin signaling pathway
mthb04723  Retrograde endocannabinoid signaling
mthb04724  Glutamatergic synapse
mthb04725  Cholinergic synapse
mthb04726  Serotonergic synapse
mthb04730  Long-term depression
mthb04810  Regulation of actin cytoskeleton
mthb04910  Insulin signaling pathway
mthb04912  GnRH signaling pathway
mthb04914  Progesterone-mediated oocyte maturation
mthb04915  Estrogen signaling pathway
mthb04916  Melanogenesis
mthb04917  Prolactin signaling pathway
mthb04919  Thyroid hormone signaling pathway
mthb04921  Oxytocin signaling pathway
mthb04926  Relaxin signaling pathway
mthb04928  Parathyroid hormone synthesis, secretion and action
mthb04929  GnRH secretion
mthb04930  Type II diabetes mellitus
mthb04933  AGE-RAGE signaling pathway in diabetic complications
mthb04934  Cushing syndrome
mthb04935  Growth hormone synthesis, secretion and action
mthb04960  Aldosterone-regulated sodium reabsorption
mthb05010  Alzheimer disease
mthb05020  Prion disease
mthb05022  Pathways of neurodegeneration - multiple diseases
mthb05034  Alcoholism
mthb05132  Salmonella infection
mthb05133  Pertussis
mthb05135  Yersinia infection
mthb05140  Leishmaniasis
mthb05142  Chagas disease
mthb05145  Toxoplasmosis
mthb05152  Tuberculosis
mthb05160  Hepatitis C
mthb05161  Hepatitis B
mthb05163  Human cytomegalovirus infection
mthb05164  Influenza A
mthb05165  Human papillomavirus infection
mthb05166  Human T-cell leukemia virus 1 infection
mthb05167  Kaposi sarcoma-associated herpesvirus infection
mthb05170  Human immunodeficiency virus 1 infection
mthb05171  Coronavirus disease - COVID-19
mthb05200  Pathways in cancer
mthb05203  Viral carcinogenesis
mthb05205  Proteoglycans in cancer
mthb05206  MicroRNAs in cancer
mthb05207  Chemical carcinogenesis - receptor activation
mthb05208  Chemical carcinogenesis - reactive oxygen species
mthb05210  Colorectal cancer
mthb05211  Renal cell carcinoma
mthb05212  Pancreatic cancer
mthb05213  Endometrial cancer
mthb05214  Glioma
mthb05215  Prostate cancer
mthb05216  Thyroid cancer
mthb05218  Melanoma
mthb05219  Bladder cancer
mthb05220  Chronic myeloid leukemia
mthb05221  Acute myeloid leukemia
mthb05223  Non-small cell lung cancer
mthb05224  Breast cancer
mthb05225  Hepatocellular carcinoma
mthb05226  Gastric cancer
mthb05230  Central carbon metabolism in cancer
mthb05231  Choline metabolism in cancer
mthb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mthb05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mthb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    126929669
   04012 ErbB signaling pathway
    126929669
   04014 Ras signaling pathway
    126929669
   04015 Rap1 signaling pathway
    126929669
   04350 TGF-beta signaling pathway
    126929669
   04370 VEGF signaling pathway
    126929669
   04371 Apelin signaling pathway
    126929669
   04668 TNF signaling pathway
    126929669
   04066 HIF-1 signaling pathway
    126929669
   04068 FoxO signaling pathway
    126929669
   04072 Phospholipase D signaling pathway
    126929669
   04071 Sphingolipid signaling pathway
    126929669
   04024 cAMP signaling pathway
    126929669
   04022 cGMP-PKG signaling pathway
    126929669
   04151 PI3K-Akt signaling pathway
    126929669
   04150 mTOR signaling pathway
    126929669
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    126929669
   04148 Efferocytosis
    126929669
  09143 Cell growth and death
   04114 Oocyte meiosis
    126929669
   04210 Apoptosis
    126929669
   04218 Cellular senescence
    126929669
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    126929669
   04520 Adherens junction
    126929669
   04540 Gap junction
    126929669
   04550 Signaling pathways regulating pluripotency of stem cells
    126929669
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    126929669
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    126929669
   04613 Neutrophil extracellular trap formation
    126929669
   04620 Toll-like receptor signaling pathway
    126929669
   04621 NOD-like receptor signaling pathway
    126929669
   04625 C-type lectin receptor signaling pathway
    126929669
   04650 Natural killer cell mediated cytotoxicity
    126929669
   04660 T cell receptor signaling pathway
    126929669
   04658 Th1 and Th2 cell differentiation
    126929669
   04659 Th17 cell differentiation
    126929669
   04657 IL-17 signaling pathway
    126929669
   04662 B cell receptor signaling pathway
    126929669
   04664 Fc epsilon RI signaling pathway
    126929669
   04666 Fc gamma R-mediated phagocytosis
    126929669
   04062 Chemokine signaling pathway
    126929669
  09152 Endocrine system
   04910 Insulin signaling pathway
    126929669
   04929 GnRH secretion
    126929669
   04912 GnRH signaling pathway
    126929669
   04915 Estrogen signaling pathway
    126929669
   04914 Progesterone-mediated oocyte maturation
    126929669
   04917 Prolactin signaling pathway
    126929669
   04921 Oxytocin signaling pathway
    126929669
   04926 Relaxin signaling pathway
    126929669
   04935 Growth hormone synthesis, secretion and action
    126929669
   04919 Thyroid hormone signaling pathway
    126929669
   04928 Parathyroid hormone synthesis, secretion and action
    126929669
   04916 Melanogenesis
    126929669
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    126929669
   04270 Vascular smooth muscle contraction
    126929669
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    126929669
  09156 Nervous system
   04724 Glutamatergic synapse
    126929669
   04725 Cholinergic synapse
    126929669
   04726 Serotonergic synapse
    126929669
   04720 Long-term potentiation
    126929669
   04730 Long-term depression
    126929669
   04723 Retrograde endocannabinoid signaling
    126929669
   04722 Neurotrophin signaling pathway
    126929669
  09158 Development and regeneration
   04360 Axon guidance
    126929669
   04380 Osteoclast differentiation
    126929669
  09159 Environmental adaptation
   04713 Circadian entrainment
    126929669
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    126929669
   05206 MicroRNAs in cancer
    126929669
   05205 Proteoglycans in cancer
    126929669
   05207 Chemical carcinogenesis - receptor activation
    126929669
   05208 Chemical carcinogenesis - reactive oxygen species
    126929669
   05203 Viral carcinogenesis
    126929669
   05230 Central carbon metabolism in cancer
    126929669
   05231 Choline metabolism in cancer
    126929669
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    126929669
  09162 Cancer: specific types
   05210 Colorectal cancer
    126929669
   05212 Pancreatic cancer
    126929669
   05225 Hepatocellular carcinoma
    126929669
   05226 Gastric cancer
    126929669
   05214 Glioma
    126929669
   05216 Thyroid cancer
    126929669
   05221 Acute myeloid leukemia
    126929669
   05220 Chronic myeloid leukemia
    126929669
   05218 Melanoma
    126929669
   05211 Renal cell carcinoma
    126929669
   05219 Bladder cancer
    126929669
   05215 Prostate cancer
    126929669
   05213 Endometrial cancer
    126929669
   05224 Breast cancer
    126929669
   05223 Non-small cell lung cancer
    126929669
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    126929669
   05170 Human immunodeficiency virus 1 infection
    126929669
   05161 Hepatitis B
    126929669
   05160 Hepatitis C
    126929669
   05171 Coronavirus disease - COVID-19
    126929669
   05164 Influenza A
    126929669
   05163 Human cytomegalovirus infection
    126929669
   05167 Kaposi sarcoma-associated herpesvirus infection
    126929669
   05165 Human papillomavirus infection
    126929669
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    126929669
   05135 Yersinia infection
    126929669
   05133 Pertussis
    126929669
   05152 Tuberculosis
    126929669
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    126929669
   05140 Leishmaniasis
    126929669
   05142 Chagas disease
    126929669
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    126929669
   05020 Prion disease
    126929669
   05022 Pathways of neurodegeneration - multiple diseases
    126929669
  09165 Substance dependence
   05034 Alcoholism
    126929669
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    126929669
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    126929669
   04933 AGE-RAGE signaling pathway in diabetic complications
    126929669
   04934 Cushing syndrome
    126929669
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    126929669
   01524 Platinum drug resistance
    126929669
   01522 Endocrine resistance
    126929669
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mthb01001]
    126929669
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mthb03036]
    126929669
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mthb04147]
    126929669
Enzymes [BR:mthb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     126929669
Protein kinases [BR:mthb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   126929669
Chromosome and associated proteins [BR:mthb03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     126929669
Exosome [BR:mthb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   126929669
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 126929669
NCBI-ProteinID: XP_050602198
LinkDB
Position
10:30304343..30413578
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtgggaccgcgctacaccaacctctcgtacatcggcgagggtgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccctttgag
caccagacctactgccagagaaccctgcgggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgacattattcgagcaccaaccatcgagcaaatgaaagat
gtatatatagtacaagacctcatggaaacagatctttacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagaggattaaaatatatc
cattcagctaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagaccatgatcac
acagggttcctgacagaatatgtggctacacgttggtacagggctccagaaattatgttg
aattccaagggctacaccaagtccattgatatttggtctgtaggctgcattctggcagaa
atgctttctaacaggcccatctttccagggaagcattatcttgaccagctgaaccacatt
ctgggtattcttggatccccatcacaagaagacctgaattgtataataaatttaaaagct
aggaactatttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggacttactggacaaaatgttgacattcaaccctcacaag
aggattgaagtagaacaggctctggcccacccatatctggagcagtattacgacccgagt
gacgagcccattgccgaagcaccattcaaattcgacatggaattggatgacttgcctaag
gaaaagctcaaagaactaatttttgaagagactgctagattccagccgggatacagatct
taa

DBGET integrated database retrieval system