KEGG   Macaca thibetana thibetana (Pere David's macaque): 126930824
Entry
126930824         CDS       T08579                                 
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
mthb  Macaca thibetana thibetana (Pere David's macaque)
Pathway
mthb01521  EGFR tyrosine kinase inhibitor resistance
mthb01522  Endocrine resistance
mthb04010  MAPK signaling pathway
mthb04012  ErbB signaling pathway
mthb04014  Ras signaling pathway
mthb04015  Rap1 signaling pathway
mthb04062  Chemokine signaling pathway
mthb04068  FoxO signaling pathway
mthb04071  Sphingolipid signaling pathway
mthb04072  Phospholipase D signaling pathway
mthb04137  Mitophagy - animal
mthb04140  Autophagy - animal
mthb04150  mTOR signaling pathway
mthb04151  PI3K-Akt signaling pathway
mthb04210  Apoptosis
mthb04211  Longevity regulating pathway
mthb04213  Longevity regulating pathway - multiple species
mthb04218  Cellular senescence
mthb04360  Axon guidance
mthb04370  VEGF signaling pathway
mthb04371  Apelin signaling pathway
mthb04540  Gap junction
mthb04550  Signaling pathways regulating pluripotency of stem cells
mthb04625  C-type lectin receptor signaling pathway
mthb04650  Natural killer cell mediated cytotoxicity
mthb04660  T cell receptor signaling pathway
mthb04662  B cell receptor signaling pathway
mthb04664  Fc epsilon RI signaling pathway
mthb04714  Thermogenesis
mthb04720  Long-term potentiation
mthb04722  Neurotrophin signaling pathway
mthb04725  Cholinergic synapse
mthb04726  Serotonergic synapse
mthb04730  Long-term depression
mthb04810  Regulation of actin cytoskeleton
mthb04910  Insulin signaling pathway
mthb04912  GnRH signaling pathway
mthb04915  Estrogen signaling pathway
mthb04916  Melanogenesis
mthb04917  Prolactin signaling pathway
mthb04919  Thyroid hormone signaling pathway
mthb04921  Oxytocin signaling pathway
mthb04926  Relaxin signaling pathway
mthb04929  GnRH secretion
mthb04933  AGE-RAGE signaling pathway in diabetic complications
mthb04935  Growth hormone synthesis, secretion and action
mthb05010  Alzheimer disease
mthb05022  Pathways of neurodegeneration - multiple diseases
mthb05034  Alcoholism
mthb05160  Hepatitis C
mthb05161  Hepatitis B
mthb05163  Human cytomegalovirus infection
mthb05165  Human papillomavirus infection
mthb05166  Human T-cell leukemia virus 1 infection
mthb05167  Kaposi sarcoma-associated herpesvirus infection
mthb05170  Human immunodeficiency virus 1 infection
mthb05200  Pathways in cancer
mthb05203  Viral carcinogenesis
mthb05205  Proteoglycans in cancer
mthb05206  MicroRNAs in cancer
mthb05207  Chemical carcinogenesis - receptor activation
mthb05208  Chemical carcinogenesis - reactive oxygen species
mthb05210  Colorectal cancer
mthb05211  Renal cell carcinoma
mthb05213  Endometrial cancer
mthb05214  Glioma
mthb05215  Prostate cancer
mthb05216  Thyroid cancer
mthb05218  Melanoma
mthb05219  Bladder cancer
mthb05220  Chronic myeloid leukemia
mthb05221  Acute myeloid leukemia
mthb05223  Non-small cell lung cancer
mthb05224  Breast cancer
mthb05225  Hepatocellular carcinoma
mthb05226  Gastric cancer
mthb05230  Central carbon metabolism in cancer
mthb05231  Choline metabolism in cancer
mthb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mthb05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mthb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    126930824
   04012 ErbB signaling pathway
    126930824
   04014 Ras signaling pathway
    126930824
   04015 Rap1 signaling pathway
    126930824
   04370 VEGF signaling pathway
    126930824
   04371 Apelin signaling pathway
    126930824
   04068 FoxO signaling pathway
    126930824
   04072 Phospholipase D signaling pathway
    126930824
   04071 Sphingolipid signaling pathway
    126930824
   04151 PI3K-Akt signaling pathway
    126930824
   04150 mTOR signaling pathway
    126930824
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    126930824
   04137 Mitophagy - animal
    126930824
  09143 Cell growth and death
   04210 Apoptosis
    126930824
   04218 Cellular senescence
    126930824
  09144 Cellular community - eukaryotes
   04540 Gap junction
    126930824
   04550 Signaling pathways regulating pluripotency of stem cells
    126930824
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    126930824
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    126930824
   04650 Natural killer cell mediated cytotoxicity
    126930824
   04660 T cell receptor signaling pathway
    126930824
   04662 B cell receptor signaling pathway
    126930824
   04664 Fc epsilon RI signaling pathway
    126930824
   04062 Chemokine signaling pathway
    126930824
  09152 Endocrine system
   04910 Insulin signaling pathway
    126930824
   04929 GnRH secretion
    126930824
   04912 GnRH signaling pathway
    126930824
   04915 Estrogen signaling pathway
    126930824
   04917 Prolactin signaling pathway
    126930824
   04921 Oxytocin signaling pathway
    126930824
   04926 Relaxin signaling pathway
    126930824
   04935 Growth hormone synthesis, secretion and action
    126930824
   04919 Thyroid hormone signaling pathway
    126930824
   04916 Melanogenesis
    126930824
  09156 Nervous system
   04725 Cholinergic synapse
    126930824
   04726 Serotonergic synapse
    126930824
   04720 Long-term potentiation
    126930824
   04730 Long-term depression
    126930824
   04722 Neurotrophin signaling pathway
    126930824
  09158 Development and regeneration
   04360 Axon guidance
    126930824
  09149 Aging
   04211 Longevity regulating pathway
    126930824
   04213 Longevity regulating pathway - multiple species
    126930824
  09159 Environmental adaptation
   04714 Thermogenesis
    126930824
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    126930824
   05206 MicroRNAs in cancer
    126930824
   05205 Proteoglycans in cancer
    126930824
   05207 Chemical carcinogenesis - receptor activation
    126930824
   05208 Chemical carcinogenesis - reactive oxygen species
    126930824
   05203 Viral carcinogenesis
    126930824
   05230 Central carbon metabolism in cancer
    126930824
   05231 Choline metabolism in cancer
    126930824
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    126930824
  09162 Cancer: specific types
   05210 Colorectal cancer
    126930824
   05225 Hepatocellular carcinoma
    126930824
   05226 Gastric cancer
    126930824
   05214 Glioma
    126930824
   05216 Thyroid cancer
    126930824
   05221 Acute myeloid leukemia
    126930824
   05220 Chronic myeloid leukemia
    126930824
   05218 Melanoma
    126930824
   05211 Renal cell carcinoma
    126930824
   05219 Bladder cancer
    126930824
   05215 Prostate cancer
    126930824
   05213 Endometrial cancer
    126930824
   05224 Breast cancer
    126930824
   05223 Non-small cell lung cancer
    126930824
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    126930824
   05170 Human immunodeficiency virus 1 infection
    126930824
   05161 Hepatitis B
    126930824
   05160 Hepatitis C
    126930824
   05163 Human cytomegalovirus infection
    126930824
   05167 Kaposi sarcoma-associated herpesvirus infection
    126930824
   05165 Human papillomavirus infection
    126930824
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    126930824
   05022 Pathways of neurodegeneration - multiple diseases
    126930824
  09165 Substance dependence
   05034 Alcoholism
    126930824
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    126930824
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    126930824
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    126930824
   01522 Endocrine resistance
    126930824
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mthb04131]
    126930824
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mthb04147]
    126930824
   04031 GTP-binding proteins [BR:mthb04031]
    126930824
Membrane trafficking [BR:mthb04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    126930824
 Endocytosis
  Macropinocytosis
   Ras GTPases
    126930824
Exosome [BR:mthb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   126930824
  Exosomal proteins of other body fluids (saliva and urine)
   126930824
  Exosomal proteins of breast cancer cells
   126930824
  Exosomal proteins of colorectal cancer cells
   126930824
GTP-binding proteins [BR:mthb04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    126930824
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 126930824
NCBI-ProteinID: XP_050604300
LinkDB
Position
1:complement(114032753..114044812)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
agaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctgga
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcggatattaatctctacagggagcagatt
aagcgagtaaaagactcagatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt
tgtatgggattaccatgtgtggtgatgtaa

DBGET integrated database retrieval system