KEGG   Macaca thibetana thibetana (Pere David's macaque): 126950508
Entry
126950508         CDS       T08579                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
mthb  Macaca thibetana thibetana (Pere David's macaque)
Pathway
mthb04010  MAPK signaling pathway
mthb04014  Ras signaling pathway
mthb04015  Rap1 signaling pathway
mthb04024  cAMP signaling pathway
mthb04062  Chemokine signaling pathway
mthb04071  Sphingolipid signaling pathway
mthb04145  Phagosome
mthb04148  Efferocytosis
mthb04151  PI3K-Akt signaling pathway
mthb04310  Wnt signaling pathway
mthb04360  Axon guidance
mthb04370  VEGF signaling pathway
mthb04380  Osteoclast differentiation
mthb04510  Focal adhesion
mthb04517  IgSF CAM signaling
mthb04520  Adherens junction
mthb04530  Tight junction
mthb04613  Neutrophil extracellular trap formation
mthb04620  Toll-like receptor signaling pathway
mthb04650  Natural killer cell mediated cytotoxicity
mthb04662  B cell receptor signaling pathway
mthb04664  Fc epsilon RI signaling pathway
mthb04666  Fc gamma R-mediated phagocytosis
mthb04670  Leukocyte transendothelial migration
mthb04722  Neurotrophin signaling pathway
mthb04810  Regulation of actin cytoskeleton
mthb04932  Non-alcoholic fatty liver disease
mthb04933  AGE-RAGE signaling pathway in diabetic complications
mthb04972  Pancreatic secretion
mthb05014  Amyotrophic lateral sclerosis
mthb05020  Prion disease
mthb05022  Pathways of neurodegeneration - multiple diseases
mthb05100  Bacterial invasion of epithelial cells
mthb05132  Salmonella infection
mthb05135  Yersinia infection
mthb05163  Human cytomegalovirus infection
mthb05167  Kaposi sarcoma-associated herpesvirus infection
mthb05169  Epstein-Barr virus infection
mthb05170  Human immunodeficiency virus 1 infection
mthb05200  Pathways in cancer
mthb05203  Viral carcinogenesis
mthb05205  Proteoglycans in cancer
mthb05208  Chemical carcinogenesis - reactive oxygen species
mthb05210  Colorectal cancer
mthb05211  Renal cell carcinoma
mthb05212  Pancreatic cancer
mthb05231  Choline metabolism in cancer
mthb05415  Diabetic cardiomyopathy
mthb05416  Viral myocarditis
mthb05417  Lipid and atherosclerosis
mthb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mthb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    126950508
   04014 Ras signaling pathway
    126950508
   04015 Rap1 signaling pathway
    126950508
   04310 Wnt signaling pathway
    126950508
   04370 VEGF signaling pathway
    126950508
   04071 Sphingolipid signaling pathway
    126950508
   04024 cAMP signaling pathway
    126950508
   04151 PI3K-Akt signaling pathway
    126950508
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    126950508
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    126950508
   04148 Efferocytosis
    126950508
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    126950508
   04520 Adherens junction
    126950508
   04530 Tight junction
    126950508
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    126950508
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    126950508
   04620 Toll-like receptor signaling pathway
    126950508
   04650 Natural killer cell mediated cytotoxicity
    126950508
   04662 B cell receptor signaling pathway
    126950508
   04664 Fc epsilon RI signaling pathway
    126950508
   04666 Fc gamma R-mediated phagocytosis
    126950508
   04670 Leukocyte transendothelial migration
    126950508
   04062 Chemokine signaling pathway
    126950508
  09154 Digestive system
   04972 Pancreatic secretion
    126950508
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    126950508
  09158 Development and regeneration
   04360 Axon guidance
    126950508
   04380 Osteoclast differentiation
    126950508
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    126950508
   05205 Proteoglycans in cancer
    126950508
   05208 Chemical carcinogenesis - reactive oxygen species
    126950508
   05203 Viral carcinogenesis
    126950508
   05231 Choline metabolism in cancer
    126950508
  09162 Cancer: specific types
   05210 Colorectal cancer
    126950508
   05212 Pancreatic cancer
    126950508
   05211 Renal cell carcinoma
    126950508
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    126950508
   05163 Human cytomegalovirus infection
    126950508
   05167 Kaposi sarcoma-associated herpesvirus infection
    126950508
   05169 Epstein-Barr virus infection
    126950508
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    126950508
   05135 Yersinia infection
    126950508
   05100 Bacterial invasion of epithelial cells
    126950508
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    126950508
   05020 Prion disease
    126950508
   05022 Pathways of neurodegeneration - multiple diseases
    126950508
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    126950508
   05418 Fluid shear stress and atherosclerosis
    126950508
   05415 Diabetic cardiomyopathy
    126950508
   05416 Viral myocarditis
    126950508
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    126950508
   04933 AGE-RAGE signaling pathway in diabetic complications
    126950508
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mthb04131]
    126950508
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mthb04147]
    126950508
   04031 GTP-binding proteins [BR:mthb04031]
    126950508
Membrane trafficking [BR:mthb04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    126950508
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    126950508
  Macropinocytosis
   Ras GTPases
    126950508
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    126950508
Exosome [BR:mthb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   126950508
  Exosomal proteins of other body fluids (saliva and urine)
   126950508
  Exosomal proteins of colorectal cancer cells
   126950508
  Exosomal proteins of bladder cancer cells
   126950508
GTP-binding proteins [BR:mthb04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    126950508
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 126950508
NCBI-ProteinID: XP_050640103
LinkDB
Position
3:143409788..143806247
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaattac
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgccccctatcctatccgcaaacagatgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgag
gtgcggcaccactgtcccaacactcccatcatcctagtgggaactaaacttgatcttagg
gatgataaagacacgatcgagaaactgaaggagaagaagctgactcccatcacctatcca
cagggtctagccatggctaaggagattggtgctgtgaaatacctggagtgctcggcgctc
acacagcgaggcctcaagacagtgtttgacgaagcgatccgagcagtcctctgcccacct
cccgtgaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system