KEGG   Microbulbifer thermotolerans: A3224_02530
Entry
A3224_02530       CDS       T04393                                 
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A3224_02530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mthd03011]
    A3224_02530
Ribosome [BR:mthd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A3224_02530
  Bacteria
    A3224_02530
  Archaea
    A3224_02530
SSDB
Motif
Pfam: Ribosomal_L18p Ribosomal_L5e
Other DBs
NCBI-ProteinID: AMX01601
UniProt: A0A143HJB8
LinkDB
Position
601907..602257
AA seq 116 aa
MNVKKASRLRRARRARAKIRELGAVRLTVNRTPRHIYAQILSAEGNKVLATASTLDKELR
AGKTGNVEAATAVGKLIAERAKAVGVEKVAFDRSGFKYHGRVKALADAAREAGLKF
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaacgttaagaaagcatctcgcttgcgtcgtgcacgtcgtgcccgcgctaaaatccgc
gagctgggcgccgttcgcctgaccgtgaaccgcaccccgcgccacatttatgcacagatc
ctgtctgctgaaggcaacaaggtactggccaccgcctctaccctcgacaaggagctgcgc
gcaggtaaaaccggcaacgttgaagctgcgaccgcggttggcaagctgattgccgagcgt
gccaaggctgtcggtgtagaaaaggtcgccttcgatcgcagtggctttaaataccacggt
cgcgtcaaggctctggctgatgcggcccgcgaagccggtttgaaattctaa

DBGET integrated database retrieval system