Microbulbifer thermotolerans: A3224_14140 Help Entry A3224_14140       CDS       T04393                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism mthd  Microbulbifer thermotolerans Brite KEGG Orthology (KO) [BR:mthd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mthd03036]     A3224_14140 Chromosome and associated proteins [BR:mthd03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     A3224_14140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Taxilin Wtap NET2A CALCOCO1 Asd-4 GIT_CC DUF7491 NRBF2 TPR_MLP1_2 PUMA_CC UPF0184 Spc7 HALZ YabA KfrA_N MctB Motif Other DBs NCBI-ProteinID:  AMX03564 UniProt:  A0A143HPA3 LinkDB All DBs Position 3428244..3428447 Genome browser AA seq 67 aa AA seqDB search MNKLQALESTVDSLIARCQQLAKDNRELRRQEADWQRERQRLIKNNEAARSRVEAMINRL KGLAQDS NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaacaagctgcaagcattagaaagcaccgtggattccctgatcgcccgctgccagcag ctggcgaaggacaaccgcgagctgcgtcggcaggaggccgactggcagcgcgagcgccag cgtctgataaaaaacaacgaggccgcccgctcacgggttgaggccatgatcaaccggctc aaggggctagcgcaagattcctga

DBGET integrated database retrieval system