KEGG   Microbulbifer thermotolerans: A3224_16355
Entry
A3224_16355       CDS       T04393                                 
Name
(GenBank) membrane protein insertase YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd02024  Quorum sensing
mthd03060  Protein export
mthd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    A3224_16355
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A3224_16355
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A3224_16355
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mthd03029]
    A3224_16355
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mthd02044]
    A3224_16355
Mitochondrial biogenesis [BR:mthd03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    A3224_16355
Secretion system [BR:mthd02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   A3224_16355
SSDB
Motif
Pfam: YidC_periplas 60KD_IMP FtsL_2 DUF7523
Other DBs
NCBI-ProteinID: AMX03954
UniProt: A0A143HQE5
LinkDB
Position
complement(3935398..3937056)
AA seq 552 aa
MDWQRYTLLGGIAAVVLALIYQWNDFQERRAPIPDRETVVREELPTSSPATQTRADNDVP
QLEAQSDTAAGKSDAQRKLISVTTDVFDLLIDPRGGDIVKVALRRYEEELHTPDRPLILL
NQTRDHTYIAQSGLIGQNGTDSAAGRPLFTVAETKYALKEGQDTLTVDLTLKQGETDITK
RFTFHRGDYLIDVTYLVDNRSSEAWSAAMFGQIKRDDQEPPVDVGIGVSPFLGAAMHTTE
ENYFKQDFEDIAEKPTRETVEGGWVAMVQHYFLSAWIPPQDERNTFELRQLSGGLYRMGF
TSPPVAIAPGNQGTLSAAFYAGPKDVYRLEEISPYLDLTVDYGWLWWIAKPLFGVLHFIQ
SHIASNWGWAIILLTVFIKALLFPLSAAGTKSMARMRKFAPQMKKLQEQYKDNRQKLAEE
TMKLYRREKINPMGGCLPIMLQMPVFIALYWMLTETVELRHAPWIFWIHDLSAKDPYFIL
PALMGLSMWFMQKLNPQPTDPTQARIMQLMPVMMTFFFLWFPAGLVLYWIANNLITIAQT
WYINKQVDAGKV
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggattggcaacgctatacactgttgggcggcatcgccgcagtggtcctggccttgata
taccagtggaacgactttcaggagcggcgcgcgccgattcccgatcgagagacagtggtg
cgtgaggaactccccaccagcagtccagccacacaaacacgggccgacaacgacgtacca
caactagaagcacagagcgacactgccgccggcaagagtgacgcgcaacgcaagttgatc
agcgtcaccacagacgtttttgacttattgatcgatccccgcggcggagacatcgtcaaa
gtcgcactgcgccggtatgaagaggaactgcacactccggatcgcccgctgatactgctg
aaccagacccgcgaccatacctatatcgcccaaagtggtttaatcgggcagaacggcacc
gacagcgccgctggccgccccttattcaccgttgcggaaaccaagtacgcactgaaggag
ggccaagacaccctcaccgtggatctgacgctcaaacagggagaaaccgacattaccaag
cggttcaccttccaccgcggggactacttaatcgacgtcacctacctggtggacaaccgc
agtagcgaggcttggtccgcggccatgttcgggcaaatcaagcgcgacgaccaagaaccc
ccggtcgacgtaggcatcggcgtgtcccccttcctcggtgcggcgatgcacactaccgaa
gaaaactacttcaagcaggactttgaggatattgccgaaaagccgactcgcgaaaccgtc
gagggcggttgggtggccatggtccagcactacttcctcagtgcctggattccgcctcag
gacgagcgcaataccttcgagctgcgccagctgtccggtgggctctaccgcatggggttc
acctcgccgccggtcgcgattgcccccggcaaccagggaacgttgagcgccgctttttat
gcgggcccgaaagacgtctaccgcctggaagaaatctccccttacctggacctcaccgtg
gattacggctggctatggtggatcgcaaagcctctgtttggcgtcctgcattttatccag
agccatatcgccagcaactggggctgggccattatccttttgacggtgttcatcaaggcg
ctgctcttccccctgtccgccgctggcaccaagtccatggctcgcatgcgtaaattcgcg
ccgcagatgaagaagctgcaggagcaatacaaagacaaccggcagaagctggcggaggag
accatgaagctctaccgccgggagaaaattaatccgatgggcggctgtctgccaattatg
ctgcagatgccggtttttatcgctctctactggatgctgaccgagacagtggagttgcgc
cacgcgccctggatattctggatccacgatctgtccgccaaggacccctactttatcctg
cccgctctgatgggcttgtccatgtggtttatgcaaaagctcaacccacagccgacagac
ccgacgcaggcgcgtatcatgcaactgatgccggtgatgatgacctttttcttcctatgg
ttcccggccggtctggtgctctactggatcgccaacaacctgatcaccattgcgcagact
tggtatatcaacaaacaggtggacgcgggcaaggtataa

DBGET integrated database retrieval system