Methanosarcina thermophila CHTI-55: MSTHC_1744 Help Entry MSTHC_1744        CDS       T03891                                  Name (GenBank) LSU ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mthe  Methanosarcina thermophila CHTI-55 Pathway mthe03010   Ribosome Brite KEGG Orthology (KO) [BR:mthe00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSTHC_1744   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSTHC_1744  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mthe03011]     MSTHC_1744    04121 Ubiquitin system [BR:mthe04121]     MSTHC_1744 Ribosome [BR:mthe03011]  Ribosomal proteins   Eukaryotes    Large subunit     MSTHC_1744   Archaea     MSTHC_1744 Ubiquitin system [BR:mthe04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSTHC_1744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR zf-AtTam37 DZR_2 Zn_ribbon_RanBP HypA zf-ChsH2 Zn_ribbon_RPAB4 DUF7129 DHHC DUF7577 Motif Other DBs NCBI-ProteinID:  AKB16062 UniProt:  A0A0E3NFR7 LinkDB All DBs Position complement(2171773..2171922) Genome browser AA seq 49 aa AA seqDB search MARFPEAEERLLNKKICMKCNARNAIRATRCRKCGSSALRVKSKESKGA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctcgttttccagaagcagaagaaagattattaaataagaaaatttgtatgaagtgt aatgccaggaatgcaataagagcaacccgctgcagaaaatgcggcagcagtgctcttcgg gttaaatccaaggaatccaagggagcatga

DBGET integrated database retrieval system