Mixta theicola: C7M52_01864 Help Entry C7M52_01864       CDS       T06402                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mthi  Mixta theicola Pathway mthi01100   Metabolic pathways mthi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mthi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C7M52_01864 (acpP)    00074 Mycolic acid biosynthesis     C7M52_01864 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C7M52_01864 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH EutQ Ribosomal_L50 DUF6952 Motif Other DBs NCBI-ProteinID:  QHM75906 LinkDB All DBs Position complement(2092713..2092949) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIISEQLGVKQEEVTNEKSFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINNHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatctccgagcagcttggcgttaagcag gaagaagtcaccaacgaaaaatctttcgttgaagatcttggcgctgattctcttgatacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagattactactgttcaggctgctattgattatatcaataaccatcaggcctaa

DBGET integrated database retrieval system