Mixta theicola: C7M52_03666 Help Entry C7M52_03666       CDS       T06402                                  Symbol grxC Name (GenBank) Glutaredoxin 3   KO K03676   glutaredoxin 3 Organism mthi  Mixta theicola Brite KEGG Orthology (KO) [BR:mthi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mthi03110]     C7M52_03666 (grxC) Chaperones and folding catalysts [BR:mthi03110]  Protein folding catalysts   Protein disulfide isomerase    C7M52_03666 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like GST_N SH3BGR CLIC-like_N Thioredoxin_3 Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  QHM77663 LinkDB All DBs Position 4072664..4072915 Genome browser AA seq 83 aa AA seqDB search MANVEIYTKATCPYCHRAKALLAQKGVAFQEIPVDGDANKREEMIKRSGRTTVPQIFIDA QHIGGCDDLYALDSREGLDPLLK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggctaacgtagagatttataccaaagcaacctgtccttactgccaccgggcaaaagcg ctgctggcgcagaaaggcgtggccttccaggaaatccctgtcgatggcgatgcgaacaag cgcgaagagatgattaagcgcagcggacgcaccaccgtgccgcagatttttatcgatgcg cagcacattggcggctgcgacgatctttacgcgttggatagccgcgaagggcttgatcct ctgctgaaataa

DBGET integrated database retrieval system