Methanothermobacter sp. THM-1: FZP57_00650 Help Entry FZP57_00650       CDS       T06420                                  Name (GenBank) tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism mthm  Methanothermobacter sp. THM-1 Pathway mthm00362   Benzoate degradation mthm01100   Metabolic pathways mthm01120   Microbial metabolism in diverse environments mthm01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:mthm00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     FZP57_00650    00622 Xylene degradation     FZP57_00650    00621 Dioxin degradation     FZP57_00650 Enzymes [BR:mthm01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      FZP57_00650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_3 Tautomerase_2 Motif Other DBs NCBI-ProteinID:  QHN05735 LinkDB All DBs Position 136269..136457 Genome browser AA seq 62 aa AA seqDB search MPVIQIYCNEITEEKKRELVKRITRVSGEVLELPESTITVLIREMPPEDVGVGGVLLCDR DQ NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgcctgttatccagatatactgcaacgagatcacggaggaaaagaagagagaacttgtt aagagaataaccagggtttcaggtgaggttctggaacttcccgagtcaaccataacggta ctgataagggagatgccccctgaagatgtgggtgtaggtggagttcttctctgtgacagg gatcagtaa

DBGET integrated database retrieval system