Mycolicibacterium thermoresistibile: 4412656_01251 Help Entry 4412656_01251     CDS       T05542                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mthn  Mycolicibacterium thermoresistibile Brite KEGG Orthology (KO) [BR:mthn00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     4412656_01251 Enzymes [BR:mthn01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      4412656_01251 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_2 Thioredoxin Glrx-like YfjL_C GST_N Motif Other DBs NCBI-ProteinID:  SNW17446 LinkDB All DBs Position 1:complement(1339401..1339625) Genome browser AA seq 74 aa AA seqDB search MYTTTWCGYCKRLQTALKAEGIPYTEVNIEEDPAAAQFVESVNNGNQTVPTVKFPDGSAL TNPSIKEVKAKLAG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgtacaccaccacctggtgcggctactgcaagcggctgcagaccgcgctgaaggccgag ggcatcccctacaccgaggtgaacatcgaggaggatccggcggcggcccagttcgtggag tcggtgaacaacggcaaccagacggtgccgacggtgaagtttccggacggctcggcgctg accaaccccagcatcaaggaagtcaaggccaagctcgcgggctga

DBGET integrated database retrieval system