Neomoorella thermoacetica DSM 521: MOTHE_c24620 Help Entry MOTHE_c24620      CDS       T06431                                  Symbol atpE Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism mtho  Neomoorella thermoacetica DSM 521 Pathway mtho00190   Oxidative phosphorylation mtho01100   Metabolic pathways Module mtho_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mtho00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     MOTHE_c24620 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mtho00194]     MOTHE_c24620 (atpE) Photosynthesis proteins [BR:mtho00194]  Photosystem and electron transport system   F-type ATPase [OT]    MOTHE_c24620 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AKX95241 UniProt:  A0A1D7XEP7 LinkDB All DBs Position complement(2406450..2406674) Genome browser AA seq 74 aa AA seqDB search MATIGFIGVGLAIGLAALGSGLGQGIASRGALEGMARQPEASGDIRTTLLLALAFMEALT LFSFVIAILMWTKL NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcaacaataggttttatcggtgtcggcctggctataggcctggcagctttgggttcg ggccttggccagggtattgcttcccggggagcgctggagggtatggcccgccagccggag gccagcggtgacatccggacgaccctgctcctggccctggcctttatggaagccttaacg ctcttctctttcgttattgcaatcctcatgtggaccaaactctaa

DBGET integrated database retrieval system