Methanosarcina thermophila TM-1: MSTHT_2416 Help Entry MSTHT_2416        CDS       T03892                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mthr  Methanosarcina thermophila TM-1 Pathway mthr03010   Ribosome Brite KEGG Orthology (KO) [BR:mthr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSTHT_2416   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSTHT_2416  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mthr03011]     MSTHT_2416    04121 Ubiquitin system [BR:mthr04121]     MSTHT_2416   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mthr04147]     MSTHT_2416 Ribosome [BR:mthr03011]  Ribosomal proteins   Eukaryotes    Small subunit     MSTHT_2416   Archaea     MSTHT_2416 Ubiquitin system [BR:mthr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSTHT_2416 Exosome [BR:mthr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MSTHT_2416   Exosomal proteins of colorectal cancer cells    MSTHT_2416 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Zn_Ribbon_TF Zn_Ribbon_1 DUF6671 Zn_ribbon_RPB9 Cas12f1-like_TNB Zn_ribbon_NUD DUF1451 Zn_ribbon_NOB1 Zn_ribbon_13 Zn_ribbon_IS1595 Baculo_ME53 Motif Other DBs NCBI-ProteinID:  AKB14174 UniProt:  A0A0E3H9I7 LinkDB All DBs Position complement(2937431..2937580) Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRIKQFCPRCGPGTFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattactataaagtccagggcgactccgtaactagaataaaacagttc tgccccaggtgcggaccaggtacattcctcgcggaccacaaaaaccgcctcgcctgcgga aaatgcggatataccgaattcaagaaataa

DBGET integrated database retrieval system