Neomoorella thermoacetica DSM 2955: MOTHA_c22570 Help Entry MOTHA_c22570      CDS       T06429                                  Symbol groS2 Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism mthz  Neomoorella thermoacetica DSM 2955 Brite KEGG Orthology (KO) [BR:mthz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mthz03110]     MOTHA_c22570 (groS2)    03029 Mitochondrial biogenesis [BR:mthz03029]     MOTHA_c22570 (groS2) Chaperones and folding catalysts [BR:mthz03110]  Heat shock proteins   HSP10    MOTHA_c22570 (groS2) Mitochondrial biogenesis [BR:mthz03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     MOTHA_c22570 (groS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 MDN1_4th Motif Other DBs NCBI-ProteinID:  AKX97593 UniProt:  A0A1J5JWL1 LinkDB All DBs Position complement(2223065..2223352) Genome browser AA seq 95 aa AA seqDB search MSFQPLGDRVLIKPLEAEEKTAAGIVLPDTAKEKPQQGEVIAVGPGRLLDNGERVKMEVK AGDRVLYARYAGTELKQGDTKYLVLSERDILAVVE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgagttttcaacctttgggcgaccgcgtcctcattaaaccccttgaggccgaagaaaaa acagcggctggcatcgtcctgccggataccgccaaggagaaaccccagcagggggaggta atagccgttggccccggccgtttgctggataatggggaacgggtaaaaatggaagtcaag gcaggggaccgggtcctctacgcccggtatgccggcaccgaactaaaacagggcgacacc aaatacctggtcctcagcgagcgcgatatcctggcggtagttgaatag

DBGET integrated database retrieval system