Massilia oculi: DIR46_22620 Help Entry DIR46_22620       CDS       T05448                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mtim  Massilia oculi Pathway mtim01100   Metabolic pathways mtim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DIR46_22620    00074 Mycolic acid biosynthesis     DIR46_22620   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DIR46_22620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 DUF5783 DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AWL06951 UniProt:  A0A2S2DNS0 LinkDB All DBs Position 5018159..5018398 Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVAEADIKIDSSFVDDLGADSLDTVELVMALEDEFEMEIPDEQA EKITTVKQAIDYATAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcggatatcgaacaacgcgttaaaaaaatcgtcgctgagcaactgggcgttgccgaa gcagacatcaaaatcgattcctcgttcgttgacgacctcggtgctgactcgctggacacc gttgaactggtgatggcactggaagacgagttcgaaatggaaatccctgacgagcaggct gagaaaatcaccaccgtcaagcaagccatcgactacgcaaccgcgcacgtcaaggcctaa

DBGET integrated database retrieval system