Methanothrix thermoacetophila: Mthe_1325 Help Entry Mthe_1325         CDS       T00417                                  Name (GenBank) SSU ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mtp  Methanothrix thermoacetophila Pathway mtp03010   Ribosome Brite KEGG Orthology (KO) [BR:mtp00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Mthe_1325   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Mthe_1325  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mtp03011]     Mthe_1325    04121 Ubiquitin system [BR:mtp04121]     Mthe_1325   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mtp04147]     Mthe_1325 Ribosome [BR:mtp03011]  Ribosomal proteins   Eukaryotes    Small subunit     Mthe_1325   Archaea     Mthe_1325 Ubiquitin system [BR:mtp04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Mthe_1325 Exosome [BR:mtp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Mthe_1325   Exosomal proteins of colorectal cancer cells    Mthe_1325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 DUF1451 Ribosomal_L37e DZR_2 IBR_1 Zn_ribbon_NUD Zn_ribbon_IS1595 IBR Lar_restr_allev Zn_Ribbon_TF Zn_ribbon_3 DUF5817 Zn_ribbon_19 Zn_ribbon_13 Zn_ribbon_Nudix Cas12f1-like_TNB MqsA_antitoxin Zn_ribbon_ACC Motif Other DBs NCBI-ProteinID:  ABK15103 UniProt:  A0B8S9 LinkDB All DBs Position 1430102..1430251 Genome browser AA seq 49 aa AA seqDB search MAVHKYYQLSGETIKARKPICPRCGNGVFLAEHEDRMSCGRCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctgtgcacaagtattatcagctcagcggcgagacgataaaggcccgaaagcccatc tgtccgaggtgcgggaatggcgtcttcctcgcggagcacgaggaccggatgagctgtggc aggtgcggctacacagagtttaagaagtaa

DBGET integrated database retrieval system