Mycobacterium tuberculosis HKBS1: HKBS1_2374 Help Entry HKBS1_2374        CDS       T03154                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mtq  Mycobacterium tuberculosis HKBS1 Pathway mtq01100   Metabolic pathways mtq01110   Biosynthesis of secondary metabolites Module mtq_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) mtq_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:mtq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HKBS1_2374 (acpP)    00074 Mycolic acid biosynthesis     HKBS1_2374 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HKBS1_2374 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 ACP_SdgA_C Toxin_SdpC PDCD10_N Herpes_US12 Motif Other DBs NCBI-ProteinID:  AHJ43020 LinkDB All DBs Position 2512606..2512953 Genome browser AA seq 115 aa AA seqDB search MPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIP DEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK NT seq 348 nt NT seq  +upstreamnt  +downstreamnt gtgcctgtcactcaggaagaaatcattgccggtatcgccgagatcatcgaagaggtaacc ggtatcgagccgtccgagatcaccccggagaagtcgttcgtcgacgacctggacatcgac tcgctgtcgatggtcgagatcgccgtgcagaccgaggacaagtacggcgtcaagatcccc gacgaggacctcgccggtctgcgtaccgtcggtgacgttgtcgcctacatccagaagctc gaggaagaaaacccggaggcggctcaggcgttgcgcgcgaagattgagtcggagaacccc gatgccgttgccaacgttcaggcgaggcttgaggccgagtccaagtga

DBGET integrated database retrieval system