Medicago truncatula (barrel medic): 11418787 Help Entry 11418787          CDS       T01716                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03083   Polycomb repressive complex mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     11418787    04120 Ubiquitin mediated proteolysis     11418787   09126 Chromosome    03083 Polycomb repressive complex     11418787  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     11418787    04121 Ubiquitin system [BR:mtr04121]     11418787    03036 Chromosome and associated proteins [BR:mtr03036]     11418787 Membrane trafficking [BR:mtr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     11418787 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      11418787    Cul7 complex      11418787 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      11418787   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      11418787 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Motif Other DBs NCBI-GeneID:  11418787 NCBI-ProteinID:  XP_003592198 UniProt:  G7IDZ6 LinkDB All DBs Position 1:complement(48711560..48711891) Genome browser AA seq 103 aa AA seqDB search MVIDYCKKHVDATAASSDEKPSEDDLKNWDAEFVKVDQATLFDLILAANYLDIKGLLDLT CQIVADMIKGKTPEEIRKTFNIKNDFTPKEEEEVRWENQWAFE NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggtgattgattactgtaagaagcatgtcgatgctactgctgcgagttctgatgaaaaa ccttcagaagatgatcttaagaattgggatgctgaattcgtgaaggttgatcaggctacg ctttttgacctcattcttgctgcaaactacttggatatcaagggcttgctggatcttacc tgccagattgtggcggacatgatcaaagggaagacaccggaggaaattcgaaagactttt aacatcaagaatgatttcactccgaaggaagaagaagaagttcgctgggaaaatcaatgg gcatttgaatga

DBGET integrated database retrieval system