Medicago truncatula (barrel medic): 11421742 Help Entry 11421742          CDS       T01716                                  Name (RefSeq) calmodulin-1   KO K02183   calmodulin Organism mtr  Medicago truncatula (barrel medic) Pathway mtr04016   MAPK signaling pathway - plant mtr04070   Phosphatidylinositol signaling system mtr04075   Plant hormone signal transduction mtr04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:mtr00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     11421742    04070 Phosphatidylinositol signaling system     11421742    04075 Plant hormone signal transduction     11421742  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     11421742  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mtr01009]     11421742   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     11421742    03036 Chromosome and associated proteins [BR:mtr03036]     11421742   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mtr04147]     11421742 Protein phosphatases and associated proteins [BR:mtr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      11421742 Membrane trafficking [BR:mtr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     11421742 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      11421742 Exosome [BR:mtr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    11421742 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 EH SPARC_Ca_bdg EF_EFCAB10_C DUF5580_M Motif Other DBs NCBI-GeneID:  11421742 NCBI-ProteinID:  XP_003600209 UniProt:  Q8LKW4 LinkDB All DBs Position 3:complement(25059964..25061396) Genome browser AA seq 140 aa AA seqDB search MVYSKSYLFLGLNLFVFLSSQALADIHVSPMLTVEPNLPSMADQLNHNQISKIKAYFSLI DKDEDGFIDNENFVAVFHMCDKDQNGFVSTSELHYFMTYIGQKVTYEDVEEFVREADFDG DGQINIEEFVKDLSRSGSNT NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggtttactcaaaatcttatttgtttcttggtcttaatctttttgtttttctctcttct caagctttagctgatattcatgtttcaccaatgcttactgttgaacccaatcttccttca atggccgatcaactcaatcacaatcaaatatcaaagataaaggcgtatttcagcctcatc gataaggatgaagatggttttattgataatgaaaattttgtggcagttttccatatgtgt gacaaggatcagaatggttttgtctctacatctgagttgcattattttatgacatatatc ggccaaaaggtgacatatgaagatgtggaagaatttgttcgtgaggctgattttgatggt gatggacaaataaacattgaggagtttgtcaaagatttgtccaggagcggatcaaacaca tga

DBGET integrated database retrieval system