Medicago truncatula (barrel medic): 11423233 Help Entry 11423233          CDS       T01716                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03083   Polycomb repressive complex mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     11423233    04120 Ubiquitin mediated proteolysis     11423233   09126 Chromosome    03083 Polycomb repressive complex     11423233  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     11423233    04121 Ubiquitin system [BR:mtr04121]     11423233    03036 Chromosome and associated proteins [BR:mtr03036]     11423233 Membrane trafficking [BR:mtr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     11423233 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      11423233    Cul7 complex      11423233 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      11423233   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      11423233 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 RE_MjaI CoV_NSP10 Motif Other DBs NCBI-GeneID:  11423233 NCBI-ProteinID:  XP_003605515 UniProt:  G7JN75 LinkDB All DBs Position 4:complement(11674705..11675317) Genome browser AA seq 152 aa AA seqDB search MASSSMKKIILKSSEGETFEIEEAVAVQSQTIKHLIGDQCANDTEIPISNVTGKILAMVI EYCKKHVDAVSSDELRKWDAEFVQVDQDTLLKLILAARYLDIKSLYDLGCMTTANNIKDK TPEEICKIFNIKDEYTPEEKEEVRRENSWAFE NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcatcatcatcaatgaagaagatcatcctgaagagttctgaaggcgagacctttgaa atcgaagaggcggtggcagttcaatcgcagacgatcaagcatttgatcggcgaccagtgt gccaatgacactgaaatccctatttcgaacgtaacaggcaagatcttggccatggttatt gagtattgcaagaaacatgttgatgctgtaagttctgatgagcttaggaagtgggacgct gaatttgtccaggtcgatcaagatactctcttgaaactcatcttggctgcaaggtatttg gacatcaagagtctatatgatcttggatgtatgactacagcaaacaacatcaaggacaag acaccggaggagatttgcaagattttcaacattaaggatgagtacacccccgaggaaaag gaggaagttcgtcgcgaaaatagttgggcctttgaatga

DBGET integrated database retrieval system