Medicago truncatula (barrel medic): 11423715
Help
Entry
11423715 CDS
T01716
Name
(RefSeq) calmodulin
KO
K02183
calmodulin
Organism
mtr
Medicago truncatula (barrel medic)
Pathway
mtr04016
MAPK signaling pathway - plant
mtr04070
Phosphatidylinositol signaling system
mtr04075
Plant hormone signal transduction
mtr04626
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:
mtr00001
]
09130 Environmental Information Processing
09132 Signal transduction
04016 MAPK signaling pathway - plant
11423715
04070 Phosphatidylinositol signaling system
11423715
04075 Plant hormone signal transduction
11423715
09150 Organismal Systems
09159 Environmental adaptation
04626 Plant-pathogen interaction
11423715
09180 Brite Hierarchies
09181 Protein families: metabolism
01009 Protein phosphatases and associated proteins [BR:
mtr01009
]
11423715
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
mtr04131
]
11423715
03036 Chromosome and associated proteins [BR:
mtr03036
]
11423715
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
mtr04147
]
11423715
Protein phosphatases and associated proteins [BR:
mtr01009
]
Protein serine/threonine phosphatases
Phosphoprotein phosphatases (PPPs)
Calcineurin (PPP3/ PP2B)
Regulatory subunits
11423715
Membrane trafficking [BR:
mtr04131
]
Exocytosis
Small GTPases and associated proteins
Rab associated proteins
11423715
Chromosome and associated proteins [BR:
mtr03036
]
Eukaryotic type
Centrosome formation proteins
Centrosome duplication proteins
Centriole replication proteins
11423715
Exosome [BR:
mtr04147
]
Exosomal proteins
Exosomal proteins of colorectal cancer cells
11423715
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
EF-hand_7
EF-hand_6
EF-hand_1
EF-hand_5
EF-hand_8
SPARC_Ca_bdg
EF-hand_9
Motif
Other DBs
NCBI-GeneID:
11423715
NCBI-ProteinID:
XP_003600210
UniProt:
Q8LKW6
LinkDB
All DBs
Position
3:complement(25063071..25070829)
Genome browser
AA seq
176 aa
AA seq
DB search
MAYSKSYLFLSINLFVFLSSQVLADIHVPPTLTVEPNLPSMADQLNDKQISKIKAYFSLI
DKDGDVSIDNEELDTLIRSTGLNPTDFGLMVARNKSATDGNGTIDFTKEELLIAFSKPNT
DHNGFVTASELHYYLTNQGIKATNEEVSDFVREADSDSDGHLSFKEFVRLGRFTVE
NT seq
531 nt
NT seq
+upstream
nt +downstream
nt
atggcttactcaaaatcatatttgtttcttagtattaatctttttgtttttctctcttca
caagttttagctgatattcatgttccaccgacgcttactgtcgaacccaatcttccttca
atggccgatcaactcaatgacaagcaaatctcaaagataaaggcgtatttcagcctcatc
gataaggatggagatgtttctattgataatgaagaacttgacactctaatacggtctact
ggcctaaacccaactgatttcggcttgatggtagcgaggaataagtctgccactgacgga
aatggtaccattgacttcaccaaagaagagcttctcatagctttctctaagcctaacacg
gatcataatggttttgtcactgcatctgagttgcattattacttgacaaatcaaggcatt
aaggcgaccaatgaagaagtgagcgactttgttcgtgaggctgattctgatagtgatgga
catctaagctttaaggagtttgtcagacttggcagattcactgtggagtga
DBGET
integrated database retrieval system