Medicago truncatula (barrel medic): 11423981 Help Entry 11423981          CDS       T01716                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr04136   Autophagy - other Brite KEGG Orthology (KO) [BR:mtr00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     11423981  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     11423981    04121 Ubiquitin system [BR:mtr04121]     11423981    03029 Mitochondrial biogenesis [BR:mtr03029]     11423981 Membrane trafficking [BR:mtr04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     11423981 Ubiquitin system [BR:mtr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    11423981 Mitochondrial biogenesis [BR:mtr03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     11423981 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 DUF4264 Motif Other DBs NCBI-GeneID:  11423981 NCBI-ProteinID:  XP_003627265 UniProt:  Q1SF86 G7L6T7 LinkDB All DBs Position 8:7148009..7151699 Genome browser AA seq 95 aa AA seqDB search MAAAESPTSVRKVVVHLRATGDAPILKQSKFKIAGTDKFAKVIDFLRRQLHRESLFVYVN SAFSPNPDELVIDLYNNFGFDGKLVVNYACSMAWG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctgctgctgaatctccaacttctgttcgtaaagtggttgttcatctcagagccacc ggtgatgctcctattctcaaacaatccaaattcaagatagctggaactgataaatttgcc aaagtgatagactttcttcgcagacagctccacagggaatcattgtttgtatatgtcaac agtgctttttcaccgaaccctgatgaactggtcattgatttgtataataattttggcttt gatggaaaactggttgtcaactacgcttgttctatggcatggggctaa

DBGET integrated database retrieval system