Medicago truncatula (barrel medic): 11425732 Help Entry 11425732          CDS       T01716                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03083   Polycomb repressive complex mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     11425732    04120 Ubiquitin mediated proteolysis     11425732   09126 Chromosome    03083 Polycomb repressive complex     11425732  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     11425732    04121 Ubiquitin system [BR:mtr04121]     11425732    03036 Chromosome and associated proteins [BR:mtr03036]     11425732 Membrane trafficking [BR:mtr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     11425732 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      11425732    Cul7 complex      11425732 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      11425732   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      11425732 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB DUF4999 IFT52_central Steroid_dh Motif Other DBs NCBI-GeneID:  11425732 NCBI-ProteinID:  XP_003605516 UniProt:  G7JN76 LinkDB All DBs Position 4:complement(11677409..11677870) Genome browser AA seq 153 aa AA seqDB search MASLSSKKIILKSYEGETFEIEEAVAMQSQTIKLLIDDDCANDTGIPISNVTSKILAMVI EYCKKHADDVSSDELRKWDAEFVQVDQDTLFNLISAANYLNIKSLLDLTCMTAADNIKDK TPEEIRKIFNIKNDDYTPEEEEAARCENSWAFE NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcatcattgtcgtcgaagaagatcatccttaagagttatgagggcgagacctttgaa atagaagaggcggtggcaatgcaatcccagacgatcaagcttttgatagacgatgactgt gccaacgacactggaatccctatttcgaacgtaaccagcaagatcttggccatggttatt gagtattgcaagaaacatgctgatgatgtaagttctgatgagcttaggaagtgggacgct gagtttgtccaggttgatcaagatactctcttcaatctcatctcggctgctaactatcta aacatcaaaagtctgttggatcttacatgcatgactgcagcagacaatatcaaggacaag acaccggaggagattcgcaagattttcaacattaagaatgatgattacactcccgaggaa gaggaggcagctcgctgtgaaaatagttgggcttttgaatga

DBGET integrated database retrieval system